Symbol:
Cldn7
Name:
claudin 7
RGD ID:
68432
Description:
Enables cell adhesion molecule binding activity and protein domain specific binding activity. Involved in several processes, including negative regulation of protein-containing complex assembly; positive regulation of cell motility; and response to ethanol. Located in basolateral plasma membrane and lateral plasma membrane. Orthologous to human CLDN7 (claudin 7); PARTICIPATES IN hepatitis C pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
claudin-7; cld-7; MGC124679
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CLDN7 (claudin 7) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB
Mus musculus (house mouse):
Cldn7 (claudin 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cldn7 (claudin 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CLDN7 (claudin 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CLDN7 (claudin 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cldn7 (claudin 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CLDN7 (claudin 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CLDN7 (claudin 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cldn7 (claudin 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
CLDN7 (claudin 7)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Cldn7 (claudin 7)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cldn7a (claudin 7a)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cldn7b (claudin 7b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
cldn7
Alliance
DIOPT (Ensembl Compara|OMA|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 55,188,670 - 55,190,871 (+) NCBI GRCr8 mRatBN7.2 10 54,689,684 - 54,692,177 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 54,689,987 - 54,692,171 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 59,352,132 - 59,354,371 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 58,840,710 - 58,842,949 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 54,347,988 - 54,350,227 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 56,576,326 - 56,578,632 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 56,576,428 - 56,578,626 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 56,321,522 - 56,323,751 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 56,810,947 - 56,813,134 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 56,825,014 - 56,826,754 (+) NCBI Celera 10 53,843,619 - 53,845,806 (+) NCBI Celera Cytogenetic Map 10 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cldn7 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO CLDN7 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of CLDN7 mRNA CTD PMID:22079256 Cldn7 Rat 1,2-dichloroethane decreases expression ISO Cldn7 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of CLDN7 mRNA CTD PMID:28960355 Cldn7 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of CLDN7 mRNA CTD PMID:30723492 Cldn7 Rat 17alpha-ethynylestradiol increases expression ISO Cldn7 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of CLDN7 mRNA CTD PMID:17942748 Cldn7 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of CLDN7 mRNA CTD PMID:15834898 and PMID:17557909 Cldn7 Rat 17alpha-ethynylestradiol multiple interactions ISO Cldn7 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CLDN7 mRNA CTD PMID:17942748 Cldn7 Rat 17beta-estradiol affects expression ISO Cldn7 (Mus musculus) 6480464 Estradiol affects the expression of CLDN7 mRNA CTD PMID:15598610 Cldn7 Rat 17beta-estradiol multiple interactions ISO CLDN7 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of CLDN7 mRNA CTD PMID:30165855 Cldn7 Rat 17beta-estradiol increases expression ISO Cldn7 (Mus musculus) 6480464 Estradiol results in increased expression of CLDN7 mRNA CTD PMID:14664709 more ... Cldn7 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Cldn7 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CLDN7 mRNA CTD PMID:17942748 Cldn7 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CLDN7 mRNA CTD PMID:27913140 Cldn7 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cldn7 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CLDN7 mRNA CTD PMID:21570461 Cldn7 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Cldn7 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Cldn7 Rat 2-acetamidofluorene increases expression EXP 6480464 2-Acetylaminofluorene results in increased expression of CLDN7 mRNA CTD PMID:17187413 Cldn7 Rat 2-hydroxypropanoic acid decreases expression ISO CLDN7 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of CLDN7 mRNA CTD PMID:30851411 Cldn7 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO CLDN7 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of CLDN7 mRNA CTD PMID:28628672 Cldn7 Rat 4,4'-sulfonyldiphenol increases expression ISO Cldn7 (Mus musculus) 6480464 bisphenol S results in increased expression of CLDN7 mRNA CTD PMID:30951980 Cldn7 Rat 4-hydroxyphenyl retinamide increases expression ISO Cldn7 (Mus musculus) 6480464 Fenretinide results in increased expression of CLDN7 mRNA CTD PMID:28973697 Cldn7 Rat 5-aza-2'-deoxycytidine multiple interactions ISO CLDN7 (Homo sapiens) 6480464 Decitabine inhibits the reaction [Smoke results in decreased expression of CLDN7 mRNA] CTD PMID:21095227 Cldn7 Rat 5-azacytidine multiple interactions ISO CLDN7 (Homo sapiens) 6480464 Cisplatin affects the reaction [Azacitidine results in decreased expression of CLDN7 mRNA] CTD PMID:36336710 Cldn7 Rat 5-azacytidine decreases expression ISO CLDN7 (Homo sapiens) 6480464 Azacitidine results in decreased expression of CLDN7 mRNA CTD PMID:36336710 Cldn7 Rat acetylsalicylic acid increases expression EXP 6480464 Aspirin results in increased expression of CLDN7 mRNA CTD PMID:12800193 Cldn7 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of CLDN7 mRNA CTD PMID:28959563 Cldn7 Rat aflatoxin B1 decreases expression ISO CLDN7 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of CLDN7 mRNA CTD PMID:22100608 and PMID:27153756 Cldn7 Rat all-trans-retinoic acid increases expression ISO Cldn7 (Mus musculus) 6480464 Tretinoin results in increased expression of CLDN7 mRNA CTD PMID:16236135 and PMID:36189433 Cldn7 Rat all-trans-retinoic acid multiple interactions ISO Cldn7 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of CLDN7 mRNA CTD PMID:36189433 Cldn7 Rat Alpinetin multiple interactions ISO CLDN7 (Homo sapiens) 6480464 alpinetin inhibits the reaction [TNF protein results in decreased expression of CLDN7 mRNA] CTD PMID:31676321 Cldn7 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CLDN7 mRNA CTD PMID:16483693 Cldn7 Rat ampicillin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of CLDN7 protein CTD PMID:30545405 Cldn7 Rat arsane affects localization ISO Cldn7 (Mus musculus) 6480464 Arsenic affects the localization of CLDN7 protein CTD PMID:24349408 Cldn7 Rat arsane increases expression ISO CLDN7 (Homo sapiens) 6480464 Arsenic results in increased expression of CLDN7 mRNA CTD PMID:24349408 Cldn7 Rat arsenic atom increases expression ISO CLDN7 (Homo sapiens) 6480464 Arsenic results in increased expression of CLDN7 mRNA CTD PMID:24349408 Cldn7 Rat arsenic atom affects localization ISO Cldn7 (Mus musculus) 6480464 Arsenic affects the localization of CLDN7 protein CTD PMID:24349408 Cldn7 Rat arsenite(3-) decreases methylation ISO CLDN7 (Homo sapiens) 6480464 arsenite results in decreased methylation of CLDN7 promoter CTD PMID:23974009 Cldn7 Rat arsenite(3-) decreases expression ISO Cldn7 (Mus musculus) 6480464 arsenite results in decreased expression of CLDN7 mRNA CTD PMID:37442281 Cldn7 Rat arsenous acid decreases response to substance ISO CLDN7 (Homo sapiens) 6480464 CLDN7 protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:20707922 Cldn7 Rat belinostat multiple interactions ISO CLDN7 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CLDN7 mRNA CTD PMID:27188386 Cldn7 Rat belinostat increases expression ISO CLDN7 (Homo sapiens) 6480464 belinostat results in increased expression of CLDN7 mRNA CTD PMID:26272509 Cldn7 Rat benzo[a]pyrene decreases expression ISO Cldn7 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of CLDN7 mRNA CTD PMID:22228805 Cldn7 Rat benzo[a]pyrene decreases expression ISO CLDN7 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of CLDN7 mRNA CTD PMID:32234424 Cldn7 Rat benzo[a]pyrene increases expression ISO Cldn7 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of CLDN7 mRNA CTD PMID:32417428 Cldn7 Rat benzo[a]pyrene decreases methylation ISO CLDN7 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of CLDN7 5' UTR more ... CTD PMID:27901495 Cldn7 Rat benzo[a]pyrene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with 1 more ... CTD PMID:18711122 Cldn7 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of CLDN7 mRNA CTD PMID:18164116 Cldn7 Rat bexarotene increases expression EXP 6480464 bexarotene results in increased expression of CLDN7 mRNA CTD PMID:16648578 Cldn7 Rat bis(2-chloroethyl) sulfide increases expression ISO CLDN7 (Homo sapiens) 6480464 Mustard Gas results in increased expression of CLDN7 mRNA CTD PMID:25102026 Cldn7 Rat bis(2-ethylhexyl) phthalate increases expression ISO CLDN7 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of CLDN7 mRNA CTD PMID:31163220 Cldn7 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CLDN7 mRNA CTD PMID:18180321 and PMID:32145629 Cldn7 Rat bisphenol A increases expression ISO Cldn7 (Mus musculus) 6480464 bisphenol A results in increased expression of CLDN7 mRNA CTD PMID:32156529 Cldn7 Rat bisphenol A decreases expression ISO Cldn7 (Mus musculus) 6480464 bisphenol A results in decreased expression of CLDN7 mRNA CTD PMID:32370801 Cldn7 Rat bisphenol A multiple interactions ISO CLDN7 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of CLDN7 mRNA CTD PMID:28628672 Cldn7 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of CLDN7 mRNA CTD PMID:25181051 Cldn7 Rat bisphenol F increases expression ISO Cldn7 (Mus musculus) 6480464 bisphenol F results in increased expression of CLDN7 mRNA CTD PMID:30951980 Cldn7 Rat butan-1-ol multiple interactions ISO CLDN7 (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of CLDN7 mRNA CTD PMID:29432896 Cldn7 Rat cadmium dichloride decreases expression ISO CLDN7 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of CLDN7 mRNA CTD PMID:38382870 and PMID:38568856 Cldn7 Rat calcitriol increases expression ISO CLDN7 (Homo sapiens) 6480464 Calcitriol results in increased expression of CLDN7 mRNA CTD PMID:26485663 Cldn7 Rat carbamazepine affects expression ISO CLDN7 (Homo sapiens) 6480464 Carbamazepine affects the expression of CLDN7 mRNA CTD PMID:25979313 Cldn7 Rat choline multiple interactions ISO Cldn7 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of CLDN7 mRNA CTD PMID:20938992 Cldn7 Rat cisplatin decreases response to substance ISO CLDN7 (Homo sapiens) 6480464 CLDN7 protein results in decreased susceptibility to Cisplatin CTD PMID:21134740 Cldn7 Rat cisplatin multiple interactions ISO CLDN7 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of CLDN7 mRNA and Cisplatin affects the reaction [Azacitidine results in decreased expression of CLDN7 mRNA] CTD PMID:27392435 and PMID:36336710 Cldn7 Rat cisplatin increases expression ISO CLDN7 (Homo sapiens) 6480464 Cisplatin results in increased expression of CLDN7 mRNA CTD PMID:27392435 Cldn7 Rat copper(II) chloride decreases expression ISO CLDN7 (Homo sapiens) 6480464 cupric chloride results in decreased expression of CLDN7 mRNA CTD PMID:38568856 Cldn7 Rat cordycepin increases expression ISO Cldn7 (Mus musculus) 6480464 cordycepin results in increased expression of CLDN7 mRNA CTD PMID:32042022 Cldn7 Rat crocidolite asbestos decreases expression ISO Cldn7 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of CLDN7 mRNA CTD PMID:29279043 Cldn7 Rat cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of CLDN7 mRNA CTD PMID:21865292 Cldn7 Rat cyclosporin A increases expression ISO CLDN7 (Homo sapiens) 6480464 Cyclosporine results in increased expression of CLDN7 mRNA CTD PMID:27989131 Cldn7 Rat DDE decreases expression ISO CLDN7 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of CLDN7 mRNA CTD PMID:38568856 Cldn7 Rat dexamethasone multiple interactions ISO CLDN7 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of CLDN7 mRNA CTD PMID:28628672 Cldn7 Rat diarsenic trioxide decreases response to substance ISO CLDN7 (Homo sapiens) 6480464 CLDN7 protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:20707922 Cldn7 Rat dibenz[a,h]anthracene multiple interactions EXP 6480464 [1 more ... CTD PMID:18711122 Cldn7 Rat dibenzo[a,l]pyrene multiple interactions EXP 6480464 [1 more ... CTD PMID:18711122 Cldn7 Rat diethylstilbestrol increases expression ISO Cldn7 (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of CLDN7 mRNA CTD PMID:14664709 and PMID:15289156 Cldn7 Rat dorsomorphin multiple interactions ISO CLDN7 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Cldn7 Rat entinostat increases expression ISO CLDN7 (Homo sapiens) 6480464 entinostat results in increased expression of CLDN7 mRNA CTD PMID:26272509 Cldn7 Rat entinostat multiple interactions ISO CLDN7 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CLDN7 mRNA CTD PMID:27188386 Cldn7 Rat ethanol multiple interactions ISO CLDN7 (Homo sapiens) 6480464 [[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of CLDN7 mRNA CTD PMID:29432896 Cldn7 Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of CLDN7 mRNA CTD PMID:18035473 Cldn7 Rat fluoranthene multiple interactions EXP 6480464 [1 more ... CTD PMID:18711122 Cldn7 Rat folic acid multiple interactions ISO Cldn7 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of CLDN7 mRNA CTD PMID:20938992 Cldn7 Rat folic acid decreases expression ISO CLDN7 (Homo sapiens) 6480464 Folic Acid results in decreased expression of CLDN7 mRNA CTD PMID:21867686 Cldn7 Rat folpet decreases expression ISO Cldn7 (Mus musculus) 6480464 folpet results in decreased expression of CLDN7 mRNA CTD PMID:31558096 Cldn7 Rat furan increases expression EXP 6480464 furan results in increased expression of CLDN7 mRNA CTD PMID:27387713 Cldn7 Rat genistein increases expression ISO Cldn7 (Mus musculus) 6480464 Genistein results in increased expression of CLDN7 mRNA CTD PMID:15289156 Cldn7 Rat gentamycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of CLDN7 protein CTD PMID:30545405 Cldn7 Rat hydrogen peroxide affects expression ISO CLDN7 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of CLDN7 mRNA CTD PMID:18661270 Cldn7 Rat indometacin multiple interactions ISO CLDN7 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of CLDN7 mRNA CTD PMID:28628672 Cldn7 Rat L-methionine multiple interactions ISO Cldn7 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of CLDN7 mRNA CTD PMID:20938992 Cldn7 Rat lead diacetate decreases expression ISO CLDN7 (Homo sapiens) 6480464 lead acetate results in decreased expression of CLDN7 mRNA CTD PMID:38568856 Cldn7 Rat leflunomide decreases expression ISO CLDN7 (Homo sapiens) 6480464 leflunomide results in decreased expression of CLDN7 mRNA CTD PMID:28988120 Cldn7 Rat mercury dibromide increases expression ISO CLDN7 (Homo sapiens) 6480464 mercuric bromide results in increased expression of CLDN7 mRNA CTD PMID:26272509 Cldn7 Rat mercury dibromide multiple interactions ISO CLDN7 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CLDN7 mRNA CTD PMID:27188386 Cldn7 Rat methotrexate affects expression ISO Cldn7 (Mus musculus) 6480464 Methotrexate affects the expression of CLDN7 mRNA CTD PMID:18502557 Cldn7 Rat methotrexate increases expression ISO CLDN7 (Homo sapiens) 6480464 Methotrexate results in increased expression of CLDN7 mRNA CTD PMID:21678067 Cldn7 Rat metronidazole multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of CLDN7 protein CTD PMID:30545405 Cldn7 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Cldn7 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of CLDN7 mRNA CTD PMID:36189433 Cldn7 Rat N-methyl-N-nitrosourea decreases expression EXP 6480464 Methylnitrosourea results in decreased expression of CLDN7 mRNA CTD PMID:16525678 Cldn7 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of CLDN7 mRNA and [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of CLDN7 mRNA CTD PMID:18164116 and PMID:20360939 Cldn7 Rat N-nitrosodiethylamine increases expression ISO Cldn7 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of CLDN7 mRNA CTD PMID:24535843 Cldn7 Rat neomycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of CLDN7 protein CTD PMID:30545405 Cldn7 Rat nickel atom decreases expression ISO CLDN7 (Homo sapiens) 6480464 Nickel results in decreased expression of CLDN7 mRNA CTD PMID:25583101 Cldn7 Rat okadaic acid increases expression ISO CLDN7 (Homo sapiens) 6480464 Okadaic Acid results in increased expression of CLDN7 mRNA CTD PMID:30926360 Cldn7 Rat ozone multiple interactions ISO Cldn7 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of CLDN7 mRNA CTD PMID:34911549 Cldn7 Rat panobinostat increases expression ISO CLDN7 (Homo sapiens) 6480464 panobinostat results in increased expression of CLDN7 mRNA CTD PMID:26272509 Cldn7 Rat panobinostat multiple interactions ISO CLDN7 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CLDN7 mRNA CTD PMID:27188386 Cldn7 Rat paracetamol decreases expression ISO CLDN7 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of CLDN7 mRNA CTD PMID:29067470 Cldn7 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of CLDN7 mRNA CTD PMID:32680482 Cldn7 Rat phenethyl caffeate multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of CLDN7 mRNA CTD PMID:20360939 Cldn7 Rat phenylmercury acetate increases expression ISO CLDN7 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of CLDN7 mRNA CTD PMID:26272509 Cldn7 Rat phenylmercury acetate multiple interactions ISO CLDN7 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CLDN7 mRNA CTD PMID:27188386 Cldn7 Rat pinostrobin increases expression ISO CLDN7 (Homo sapiens) 6480464 pinostrobin results in increased expression of CLDN7 mRNA CTD PMID:37777166 Cldn7 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of CLDN7 mRNA CTD PMID:12832660 Cldn7 Rat pirinixic acid multiple interactions ISO CLDN7 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of CLDN7 mRNA CTD PMID:19710929 Cldn7 Rat potassium chromate decreases expression ISO CLDN7 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of CLDN7 mRNA CTD PMID:22079256 Cldn7 Rat potassium chromate multiple interactions ISO CLDN7 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of CLDN7 mRNA CTD PMID:22079256 Cldn7 Rat rac-lactic acid decreases expression ISO CLDN7 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of CLDN7 mRNA CTD PMID:30851411 Cldn7 Rat SB 431542 multiple interactions ISO CLDN7 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Cldn7 Rat silicon dioxide decreases expression ISO CLDN7 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of CLDN7 mRNA CTD PMID:25895662 Cldn7 Rat sirolimus increases expression EXP 6480464 Sirolimus results in increased expression of CLDN7 mRNA CTD PMID:21865292 Cldn7 Rat sodium arsenite affects localization ISO Cldn7 (Mus musculus) 6480464 sodium arsenite affects the localization of CLDN7 protein CTD PMID:24349408 Cldn7 Rat sodium arsenite decreases expression ISO CLDN7 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of CLDN7 mRNA CTD PMID:29301061 and PMID:38568856 Cldn7 Rat sodium arsenite increases expression ISO CLDN7 (Homo sapiens) 6480464 sodium arsenite results in increased expression of CLDN7 mRNA CTD PMID:24349408 Cldn7 Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of CLDN7 mRNA CTD PMID:22561333 Cldn7 Rat sodium dodecyl sulfate increases expression ISO CLDN7 (Homo sapiens) 6480464 Sodium Dodecyl Sulfate results in increased expression of CLDN7 mRNA CTD PMID:31734321 Cldn7 Rat sulforaphane decreases expression ISO CLDN7 (Homo sapiens) 6480464 sulforaphane results in decreased expression of CLDN7 mRNA CTD PMID:31838189 Cldn7 Rat tacrolimus hydrate increases expression EXP 6480464 Tacrolimus results in increased expression of CLDN7 mRNA CTD PMID:21865292 Cldn7 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of CLDN7 mRNA CTD PMID:23411599 Cldn7 Rat thiram decreases expression ISO CLDN7 (Homo sapiens) 6480464 Thiram results in decreased expression of CLDN7 mRNA CTD PMID:38568856 Cldn7 Rat titanium dioxide increases methylation ISO Cldn7 (Mus musculus) 6480464 titanium dioxide results in increased methylation of CLDN7 gene CTD PMID:35295148 Cldn7 Rat tributylstannane increases expression ISO Cldn7 (Mus musculus) 6480464 tributyltin results in increased expression of CLDN7 mRNA CTD PMID:31939706 Cldn7 Rat trichostatin A increases expression ISO CLDN7 (Homo sapiens) 6480464 trichostatin A results in increased expression of CLDN7 mRNA CTD PMID:24935251 and PMID:26272509 Cldn7 Rat trichostatin A multiple interactions ISO CLDN7 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CLDN7 mRNA CTD PMID:27188386 Cldn7 Rat tunicamycin increases expression ISO CLDN7 (Homo sapiens) 6480464 Tunicamycin results in increased expression of CLDN7 mRNA CTD PMID:38498338 Cldn7 Rat valproic acid affects expression ISO CLDN7 (Homo sapiens) 6480464 Valproic Acid affects the expression of CLDN7 mRNA CTD PMID:25979313 Cldn7 Rat valproic acid multiple interactions ISO CLDN7 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CLDN7 mRNA CTD PMID:27188386 Cldn7 Rat valproic acid increases expression ISO CLDN7 (Homo sapiens) 6480464 Valproic Acid results in increased expression of CLDN7 mRNA CTD PMID:23179753 more ... Cldn7 Rat vancomycin decreases expression ISO Cldn7 (Mus musculus) 6480464 Vancomycin results in decreased expression of CLDN7 mRNA CTD PMID:18930951 Cldn7 Rat vancomycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of CLDN7 protein CTD PMID:30545405 Cldn7 Rat vorinostat multiple interactions ISO CLDN7 (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CLDN7 mRNA CTD PMID:27188386
Imported Annotations - KEGG (archival)
(-)-epigallocatechin 3-gallate (ISO) 1,2-dichloroethane (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-acetamidofluorene (EXP) 2-hydroxypropanoic acid (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 5-azacytidine (ISO) acetylsalicylic acid (EXP) acrylamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) Alpinetin (ISO) ammonium chloride (EXP) ampicillin (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) belinostat (ISO) benzo[a]pyrene (EXP,ISO) beta-naphthoflavone (EXP) bexarotene (EXP) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butan-1-ol (ISO) cadmium dichloride (ISO) calcitriol (ISO) carbamazepine (ISO) choline (ISO) cisplatin (ISO) copper(II) chloride (ISO) cordycepin (ISO) crocidolite asbestos (ISO) cyclosporin A (EXP,ISO) DDE (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) dibenz[a,h]anthracene (EXP) dibenzo[a,l]pyrene (EXP) diethylstilbestrol (ISO) dorsomorphin (ISO) entinostat (ISO) ethanol (ISO) flavonoids (EXP) fluoranthene (EXP) folic acid (ISO) folpet (ISO) furan (EXP) genistein (ISO) gentamycin (EXP) hydrogen peroxide (ISO) indometacin (ISO) L-methionine (ISO) lead diacetate (ISO) leflunomide (ISO) mercury dibromide (ISO) methotrexate (ISO) metronidazole (EXP) mono(2-ethylhexyl) phthalate (ISO) N-methyl-N-nitrosourea (EXP) N-nitrosodiethylamine (EXP,ISO) neomycin (EXP) nickel atom (ISO) okadaic acid (ISO) ozone (ISO) panobinostat (ISO) paracetamol (ISO) paraquat (EXP) phenethyl caffeate (EXP) phenylmercury acetate (ISO) pinostrobin (ISO) pirinixic acid (EXP,ISO) potassium chromate (ISO) rac-lactic acid (ISO) SB 431542 (ISO) silicon dioxide (ISO) sirolimus (EXP) sodium arsenite (ISO) sodium dichromate (EXP) sodium dodecyl sulfate (ISO) sulforaphane (ISO) tacrolimus hydrate (EXP) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) tributylstannane (ISO) trichostatin A (ISO) tunicamycin (ISO) valproic acid (ISO) vancomycin (EXP,ISO) vorinostat (ISO)
1.
Chronic alcohol ingestion alters claudin expression in the alveolar epithelium of rats.
Fernandez AL, etal., Alcohol. 2007 Aug;41(5):371-9.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Claudin-7 expressed on lateral membrane of rat epididymal epithelium does not form aberrant tight junction strands.
Inai T, etal., Anat Rec (Hoboken). 2007 Nov;290(11):1431-8.
4.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
5.
Claudin multigene family encoding four-transmembrane domain protein components of tight junction strands.
Morita K, etal., Proc Natl Acad Sci U S A 1999 Jan 19;96(2):511-6.
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
Claudin-7 regulates EpCAM-mediated functions in tumor progression.
Nubel T, etal., Mol Cancer Res. 2009 Mar;7(3):285-99. doi: 10.1158/1541-7786.MCR-08-0200. Epub 2009 Mar 10.
8.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
9.
Claudin 7 is reduced in uterine epithelial cells during early pregnancy in the rat.
Poon CE, etal., Histochem Cell Biol. 2013 Apr;139(4):583-93. doi: 10.1007/s00418-012-1052-y. Epub 2012 Nov 21.
10.
GOA pipeline
RGD automated data pipeline
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
13.
EpCAM-associated claudin-7 supports lymphatic spread and drug resistance in rat pancreatic cancer.
Thuma F and Zoller M, Int J Cancer. 2013 Aug 15;133(4):855-66. doi: 10.1002/ijc.28085. Epub 2013 Mar 9.
Cldn7 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 55,188,670 - 55,190,871 (+) NCBI GRCr8 mRatBN7.2 10 54,689,684 - 54,692,177 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 54,689,987 - 54,692,171 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 59,352,132 - 59,354,371 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 58,840,710 - 58,842,949 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 54,347,988 - 54,350,227 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 56,576,326 - 56,578,632 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 56,576,428 - 56,578,626 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 56,321,522 - 56,323,751 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 56,810,947 - 56,813,134 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 56,825,014 - 56,826,754 (+) NCBI Celera 10 53,843,619 - 53,845,806 (+) NCBI Celera Cytogenetic Map 10 q24 NCBI
CLDN7 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 7,259,903 - 7,263,213 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 7,259,903 - 7,263,983 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 7,163,222 - 7,166,532 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 7,103,946 - 7,106,519 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 7,104,183 - 7,106,513 NCBI Celera 17 7,187,867 - 7,191,157 (-) NCBI Celera Cytogenetic Map 17 p13.1 NCBI HuRef 17 7,054,628 - 7,057,918 (-) NCBI HuRef CHM1_1 17 7,172,020 - 7,175,309 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 7,160,826 - 7,164,136 (-) NCBI T2T-CHM13v2.0
Cldn7 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 69,855,605 - 69,858,712 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 69,855,605 - 69,858,711 (+) Ensembl GRCm39 Ensembl GRCm38 11 69,964,779 - 69,967,886 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 69,964,779 - 69,967,885 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 69,779,003 - 69,781,380 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 69,781,696 - 69,784,073 (+) NCBI MGSCv36 mm8 Celera 11 77,513,435 - 77,515,812 (+) NCBI Celera Cytogenetic Map 11 B3 NCBI cM Map 11 42.94 NCBI
Cldn7 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955467 9,652,093 - 9,654,291 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955467 9,652,093 - 9,654,291 (+) NCBI ChiLan1.0 ChiLan1.0
CLDN7 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 14,852,538 - 14,855,530 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 16,818,544 - 16,821,522 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 7,289,766 - 7,292,433 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 7,277,313 - 7,281,859 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 7,277,313 - 7,281,859 (-) Ensembl panpan1.1 panPan2
CLDN7 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 32,223,985 - 32,225,795 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 32,224,040 - 32,226,168 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 32,362,233 - 32,364,044 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 32,329,561 - 32,331,372 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 32,329,616 - 32,331,372 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 32,294,842 - 32,296,653 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 32,253,867 - 32,255,678 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 32,430,822 - 32,432,633 (-) NCBI UU_Cfam_GSD_1.0
Cldn7
CLDN7 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 52,612,510 - 52,628,362 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 52,612,517 - 52,628,376 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 54,822,459 - 54,828,675 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CLDN7 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 6,632,695 - 6,635,994 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 6,630,412 - 6,635,327 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 14,774,139 - 14,777,617 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cldn7
.
Predicted Target Of
Count of predictions: 62 Count of miRNA genes: 54 Interacting mature miRNAs: 59 Transcripts: ENSRNOT00000023291 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 152025227 Bw195 Body weight QTL 195 5.73 body mass (VT:0001259) 10 46989699 68663659 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 2293669 Bmd33 Bone mineral density QTL 33 4.5 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 10 49444551 81709989 Rat 152025224 Bw193 Body weight QTL 193 6.47 body mass (VT:0001259) 10 51663405 75085664 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 2293679 Bmd30 Bone mineral density QTL 30 3.5 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 1578762 Toxo1 Toxoplasma gondii resistance QTL 1 brain integrity trait (VT:0010579) percentage of study population displaying Toxoplasma gondii brain cysts at a point in time (CMO:0002028) 10 52200030 59378278 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2293652 Bmd22 Bone mineral density QTL 22 4.9 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2306787 Ean3 Experimental allergic neuritis QTL 3 3.1 nervous system integrity trait (VT:0010566) body weight loss (CMO:0001399) 10 53797385 66979128 Rat 6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 1354585 Eae18a Experimental allergic encephalomyelitis QTL 18a 7.5 0.0004 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 10 53797385 58445852 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2293705 Bmd25 Bone mineral density QTL 25 7.1 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 49444551 81709989 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 7207811 Bmd90 Bone mineral density QTL 90 5.2 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 10 49444551 81709989 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat
UniSTS:465381
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 54,690,371 - 54,691,994 (+) MAPPER mRatBN7.2 Rnor_6.0 10 56,576,827 - 56,578,449 NCBI Rnor6.0 Rnor_5.0 10 56,321,946 - 56,323,568 UniSTS Rnor5.0 RGSC_v3.4 10 56,811,332 - 56,812,954 UniSTS RGSC3.4 Celera 10 53,844,004 - 53,845,626 UniSTS Cytogenetic Map 10 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
32
88
91
90
59
25
59
6
199
78
68
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000023291 ⟹ ENSRNOP00000023291
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 54,689,987 - 54,692,171 (+) Ensembl Rnor_6.0 Ensembl 10 56,576,442 - 56,578,626 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000079237 ⟹ ENSRNOP00000069209
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 10 56,576,428 - 56,578,626 (+) Ensembl
RefSeq Acc Id:
NM_031702 ⟹ NP_113890
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 55,188,670 - 55,190,871 (+) NCBI mRatBN7.2 10 54,689,973 - 54,692,174 (+) NCBI Rnor_6.0 10 56,576,442 - 56,578,629 (+) NCBI Rnor_5.0 10 56,321,522 - 56,323,751 (+) NCBI RGSC_v3.4 10 56,810,947 - 56,813,134 (+) RGD Celera 10 53,843,619 - 53,845,806 (+) RGD
Sequence:
GCCTGCTCCTTCGCTGCGCACCGCAGCCCGGGACCCAAGGGCCCGCAGACTTTCTGGGGCCACGCCCTAACAGCCCCTCCACTTCTTGGGGAAGTCTCAGTTGTGAGAGTGTCGCTTCACCGGAGGGG
hide sequence
RefSeq Acc Id:
NP_113890 ⟸ NM_031702
- UniProtKB:
Q3T1J0 (UniProtKB/Swiss-Prot), Q9Z1L1 (UniProtKB/Swiss-Prot), B0K006 (UniProtKB/TrEMBL)
- Sequence:
MANSGLQLLGFSMAMLGWVGLIASTAIPQWQMSSYAGDNIITAQAMYKGLWMECVTQSTGMMSCKMYDSVLALPAATQATRALMIVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMTGGIIFIV
hide sequence
Ensembl Acc Id:
ENSRNOP00000069209 ⟸ ENSRNOT00000079237
Ensembl Acc Id:
ENSRNOP00000023291 ⟸ ENSRNOT00000023291
RGD ID: 13697348 Promoter ID: EPDNEW_R7865 Type: single initiation site Name: Cldn7_1 Description: claudin 7 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 56,576,420 - 56,576,480 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Cldn7
claudin 7
Name updated
70584 APPROVED
