Symbol:
Bcam
Name:
basal cell adhesion molecule (Lutheran blood group)
RGD ID:
68378
Description:
Predicted to enable laminin binding activity and laminin receptor activity. Predicted to be involved in angiogenesis and cell-matrix adhesion. Predicted to act upstream of or within cell adhesion. Predicted to be located in cell surface. Predicted to be active in plasma membrane. Orthologous to human BCAM (basal cell adhesion molecule (Lutheran blood group)); INTERACTS WITH 1,1-dichloroethene; 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
B-CAM cell surface glycoprotein; basal cell adhesion molecule; Lu; lutheran antigen; Lutheran blood group (Auberger b antigen included)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
BCAM (basal cell adhesion molecule (Lutheran blood group)) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Bcam (basal cell adhesion molecule) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Bcam (basal cell adhesion molecule (Lutheran blood group)) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
BCAM (basal cell adhesion molecule (Lutheran blood group)) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
BCAM (basal cell adhesion molecule) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Bcam (basal cell adhesion molecule (Lutheran blood group)) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
BCAM (basal cell adhesion molecule) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
BCAM (basal cell adhesion molecule (Lutheran blood group)) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Bcam (basal cell adhesion molecule (Lutheran blood group)) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
NPW (neuropeptide W) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
BCAM (basal cell adhesion molecule (Lutheran blood group))
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Bcam (basal cell adhesion molecule)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
bcam (basal cell adhesion molecule (Lutheran blood group))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
bcam
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 88,542,971 - 88,557,358 (-) NCBI GRCr8 mRatBN7.2 1 79,415,016 - 79,429,403 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 79,415,017 - 79,429,403 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 84,809,588 - 84,823,988 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 93,361,117 - 93,375,464 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 86,564,702 - 86,579,102 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 80,674,463 - 80,689,122 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 80,674,444 - 80,689,171 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 81,939,821 - 81,954,480 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 79,067,352 - 79,081,739 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 79,145,463 - 79,159,850 (-) NCBI Celera 1 73,873,493 - 73,887,880 (-) NCBI Celera Cytogenetic Map 1 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Bcam Rat 1,1-dichloroethene increases expression EXP 6480464 vinylidene chloride results in increased expression of BCAM protein CTD PMID:14565772 Bcam Rat 1,2-dimethylhydrazine increases expression ISO Bcam (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of BCAM mRNA CTD PMID:22206623 Bcam Rat 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine increases expression EXP 6480464 chlorcyclizine results in increased expression of BCAM mRNA CTD PMID:21058326 Bcam Rat 17beta-estradiol multiple interactions ISO BCAM (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of BCAM mRNA and [Estradiol co-treated with TGFB1 protein] results in decreased expression of BCAM mRNA CTD PMID:19619570 and PMID:30165855 Bcam Rat 17beta-estradiol decreases expression ISO BCAM (Homo sapiens) 6480464 Estradiol results in decreased expression of BCAM mRNA CTD PMID:19619570 and PMID:21185374 Bcam Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO BCAM (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Bcam Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO BCAM (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of BCAM mRNA CTD PMID:19619570 Bcam Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of BCAM mRNA CTD PMID:33387578 Bcam Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of BCAM mRNA CTD PMID:34747641 Bcam Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Bcam (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of BCAM mRNA CTD PMID:21570461 Bcam Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Bcam (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of BCAM mRNA CTD PMID:21354282 and PMID:33956508 Bcam Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO BCAM (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of BCAM mRNA CTD PMID:19619570 Bcam Rat 2,4,6-tribromophenol increases expression ISO BCAM (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Bcam Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Bcam (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Bcam Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Bcam Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO BCAM (Homo sapiens) 6480464 3 more ... CTD PMID:29947894 Bcam Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO BCAM (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of BCAM protein CTD PMID:31675489 Bcam Rat 4,4'-diaminodiphenylmethane increases expression ISO Bcam (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of BCAM mRNA CTD PMID:18648102 Bcam Rat 4,4'-sulfonyldiphenol increases expression ISO Bcam (Mus musculus) 6480464 bisphenol S results in increased expression of BCAM mRNA CTD PMID:30951980 Bcam Rat 4,4'-sulfonyldiphenol increases methylation ISO Bcam (Mus musculus) 6480464 bisphenol S results in increased methylation of BCAM exon CTD PMID:33297965 Bcam Rat 4-vinylcyclohexene dioxide affects expression ISO Bcam (Mus musculus) 6480464 4-vinyl-1-cyclohexene dioxide affects the expression of BCAM mRNA CTD PMID:20829426 Bcam Rat aflatoxin B1 increases methylation ISO BCAM (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of BCAM intron CTD PMID:30157460 Bcam Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of BCAM mRNA CTD PMID:16483693 Bcam Rat arsane multiple interactions ISO BCAM (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of BCAM mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of BCAM mRNA CTD PMID:39836092 Bcam Rat arsenic atom multiple interactions ISO BCAM (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of BCAM mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of BCAM mRNA CTD PMID:39836092 Bcam Rat benzo[a]pyrene increases expression ISO Bcam (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of BCAM mRNA CTD PMID:27195522 and PMID:32417428 Bcam Rat benzo[a]pyrene decreases methylation ISO BCAM (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of BCAM promoter CTD PMID:27901495 Bcam Rat beta-lapachone decreases expression ISO BCAM (Homo sapiens) 6480464 beta-lapachone results in decreased expression of BCAM mRNA CTD PMID:38218311 Bcam Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Bcam (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of BCAM mRNA CTD PMID:39150890 Bcam Rat bis(2-ethylhexyl) phthalate increases expression ISO Bcam (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of BCAM mRNA CTD PMID:33754040 Bcam Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of BCAM mRNA CTD PMID:25181051 Bcam Rat bisphenol A increases expression ISO Bcam (Mus musculus) 6480464 bisphenol A results in increased expression of BCAM mRNA CTD PMID:32156529 Bcam Rat bisphenol A increases expression ISO BCAM (Homo sapiens) 6480464 bisphenol A results in increased expression of BCAM protein CTD PMID:37567409 Bcam Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of BCAM mRNA CTD PMID:34947998 Bcam Rat bisphenol A affects expression ISO BCAM (Homo sapiens) 6480464 bisphenol A affects the expression of BCAM mRNA CTD PMID:30903817 Bcam Rat bisphenol F increases expression ISO Bcam (Mus musculus) 6480464 bisphenol F results in increased expression of BCAM mRNA CTD PMID:30951980 Bcam Rat butanal decreases expression ISO BCAM (Homo sapiens) 6480464 butyraldehyde results in decreased expression of BCAM mRNA CTD PMID:26079696 Bcam Rat Butylbenzyl phthalate multiple interactions ISO Bcam (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of BCAM mRNA CTD PMID:39150890 Bcam Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of BCAM mRNA CTD PMID:19167457 Bcam Rat cadmium atom multiple interactions ISO Bcam (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of BCAM mRNA CTD PMID:37325564 Bcam Rat cadmium dichloride decreases expression ISO BCAM (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of BCAM protein CTD PMID:24527689 Bcam Rat cadmium dichloride multiple interactions ISO Bcam (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of BCAM mRNA CTD PMID:37325564 Bcam Rat caffeine affects phosphorylation ISO BCAM (Homo sapiens) 6480464 Caffeine affects the phosphorylation of BCAM protein CTD PMID:35688186 Bcam Rat calcitriol increases expression ISO BCAM (Homo sapiens) 6480464 Calcitriol results in increased expression of BCAM mRNA CTD PMID:26485663 Bcam Rat carbon nanotube decreases expression ISO Bcam (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of BCAM mRNA CTD PMID:25620056 Bcam Rat chlordecone decreases expression ISO Bcam (Mus musculus) 6480464 Chlordecone results in decreased expression of BCAM mRNA CTD PMID:33711761 Bcam Rat choline multiple interactions ISO Bcam (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of BCAM mRNA CTD PMID:20938992 Bcam Rat cisplatin affects response to substance ISO BCAM (Homo sapiens) 6480464 BCAM protein affects the susceptibility to Cisplatin CTD PMID:16217747 Bcam Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of BCAM mRNA CTD PMID:26577399 Bcam Rat cyclosporin A decreases expression ISO BCAM (Homo sapiens) 6480464 Cyclosporine results in decreased expression of BCAM mRNA CTD PMID:25562108 Bcam Rat decabromodiphenyl ether increases expression ISO BCAM (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of BCAM protein CTD PMID:31675489 Bcam Rat dibutyl phthalate multiple interactions ISO Bcam (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of BCAM mRNA CTD PMID:39150890 Bcam Rat diethyl phthalate multiple interactions ISO Bcam (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of BCAM mRNA CTD PMID:39150890 Bcam Rat diisobutyl phthalate multiple interactions ISO Bcam (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of BCAM mRNA CTD PMID:39150890 Bcam Rat diisononyl phthalate multiple interactions ISO Bcam (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of BCAM mRNA CTD PMID:39150890 Bcam Rat doxorubicin affects expression ISO BCAM (Homo sapiens) 6480464 Doxorubicin affects the expression of BCAM protein CTD PMID:29385562 Bcam Rat doxorubicin decreases expression ISO BCAM (Homo sapiens) 6480464 Doxorubicin results in decreased expression of BCAM mRNA CTD PMID:29803840 Bcam Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of BCAM mRNA CTD PMID:29391264 Bcam Rat ethanol decreases expression ISO Bcam (Mus musculus) 6480464 Ethanol results in decreased expression of BCAM mRNA CTD PMID:19167417 Bcam Rat ethanol increases expression ISO Bcam (Mus musculus) 6480464 Ethanol results in increased expression of BCAM mRNA CTD PMID:30319688 Bcam Rat folic acid multiple interactions ISO Bcam (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of BCAM mRNA CTD PMID:20938992 Bcam Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of BCAM mRNA CTD PMID:33387578 Bcam Rat hydrogen cyanide decreases expression ISO Bcam (Mus musculus) 6480464 Hydrogen Cyanide results in decreased expression of BCAM mRNA CTD PMID:33914522 Bcam Rat ivermectin decreases expression ISO BCAM (Homo sapiens) 6480464 Ivermectin results in decreased expression of BCAM protein CTD PMID:32959892 Bcam Rat L-methionine multiple interactions ISO Bcam (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of BCAM mRNA CTD PMID:20938992 Bcam Rat lead(0) affects expression ISO BCAM (Homo sapiens) 6480464 Lead affects the expression of BCAM mRNA CTD PMID:28903495 Bcam Rat manganese atom multiple interactions ISO BCAM (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of BCAM mRNA CTD PMID:39836092 Bcam Rat manganese(0) multiple interactions ISO BCAM (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of BCAM mRNA CTD PMID:39836092 Bcam Rat manganese(II) chloride multiple interactions ISO BCAM (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of BCAM mRNA CTD PMID:39836092 Bcam Rat methoxychlor affects expression ISO Bcam (Mus musculus) 6480464 Methoxychlor affects the expression of BCAM mRNA CTD PMID:20829426 Bcam Rat mitoxantrone affects response to substance ISO BCAM (Homo sapiens) 6480464 BCAM protein affects the susceptibility to Mitoxantrone CTD PMID:16217747 Bcam Rat N-methyl-4-phenylpyridinium increases expression ISO BCAM (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of BCAM mRNA CTD PMID:24810058 Bcam Rat nickel atom decreases expression ISO BCAM (Homo sapiens) 6480464 Nickel results in decreased expression of BCAM mRNA CTD PMID:24768652 and PMID:25583101 Bcam Rat ochratoxin A increases expression EXP 6480464 ochratoxin A results in increased expression of BCAM mRNA CTD PMID:37162024 Bcam Rat ochratoxin A decreases methylation EXP 6480464 ochratoxin A results in decreased methylation of BCAM gene CTD PMID:37162024 Bcam Rat ozone decreases expression ISO Bcam (Mus musculus) 6480464 Ozone results in decreased expression of BCAM mRNA CTD PMID:33026818 Bcam Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of BCAM mRNA CTD PMID:33387578 Bcam Rat pirinixic acid increases expression ISO Bcam (Mus musculus) 6480464 pirinixic acid results in increased expression of BCAM mRNA CTD PMID:18445702 Bcam Rat potassium cyanide increases expression ISO Bcam (Mus musculus) 6480464 Potassium Cyanide results in increased expression of BCAM mRNA CTD PMID:33914522 Bcam Rat quercetin decreases expression ISO BCAM (Homo sapiens) 6480464 Quercetin results in decreased expression of BCAM mRNA CTD PMID:21632981 Bcam Rat resveratrol multiple interactions ISO BCAM (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of BCAM mRNA CTD PMID:23557933 Bcam Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of BCAM mRNA CTD PMID:28374803 Bcam Rat SB 431542 increases expression ISO BCAM (Homo sapiens) 6480464 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide results in increased expression of BCAM protein CTD PMID:25670856 Bcam Rat sodium arsenite decreases expression ISO BCAM (Homo sapiens) 6480464 sodium arsenite results in decreased expression of BCAM mRNA CTD PMID:38568856 Bcam Rat sodium arsenite multiple interactions ISO BCAM (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of BCAM mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of BCAM mRNA CTD PMID:39836092 Bcam Rat sodium arsenite increases expression ISO BCAM (Homo sapiens) 6480464 sodium arsenite results in increased expression of BCAM mRNA CTD PMID:34032870 Bcam Rat sodium fluoride increases expression ISO Bcam (Mus musculus) 6480464 Sodium Fluoride results in increased expression of BCAM protein CTD PMID:28918527 Bcam Rat sulforaphane decreases expression ISO BCAM (Homo sapiens) 6480464 sulforaphane results in decreased expression of BCAM mRNA CTD PMID:31838189 Bcam Rat sulindac sulfide decreases expression ISO BCAM (Homo sapiens) 6480464 sulindac sulfide results in decreased expression of BCAM mRNA CTD PMID:12734198 Bcam Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of BCAM protein CTD PMID:35544339 Bcam Rat titanium dioxide decreases expression ISO Bcam (Mus musculus) 6480464 titanium dioxide results in decreased expression of BCAM mRNA CTD PMID:23557971 Bcam Rat tolcapone affects binding EXP 6480464 tolcapone binds to BCAM protein CTD PMID:19783845 Bcam Rat trichloroethene affects expression ISO Bcam (Mus musculus) 6480464 Trichloroethylene affects the expression of BCAM mRNA CTD PMID:21135412 Bcam Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of BCAM mRNA CTD PMID:33387578 Bcam Rat valproic acid affects expression ISO BCAM (Homo sapiens) 6480464 Valproic Acid affects the expression of BCAM mRNA CTD PMID:25979313 Bcam Rat vancomycin decreases expression ISO Bcam (Mus musculus) 6480464 Vancomycin results in decreased expression of BCAM mRNA CTD PMID:18930951
1,1-dichloroethene (EXP) 1,2-dimethylhydrazine (ISO) 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine (EXP) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP,ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-vinylcyclohexene dioxide (ISO) aflatoxin B1 (ISO) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butanal (ISO) Butylbenzyl phthalate (ISO) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) calcitriol (ISO) carbon nanotube (ISO) chlordecone (ISO) choline (ISO) cisplatin (ISO) Cuprizon (EXP) cyclosporin A (ISO) decabromodiphenyl ether (ISO) dibutyl phthalate (ISO) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) doxorubicin (ISO) endosulfan (EXP) ethanol (ISO) folic acid (ISO) gentamycin (EXP) hydrogen cyanide (ISO) ivermectin (ISO) L-methionine (ISO) lead(0) (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methoxychlor (ISO) mitoxantrone (ISO) N-methyl-4-phenylpyridinium (ISO) nickel atom (ISO) ochratoxin A (EXP) ozone (ISO) paracetamol (EXP) pirinixic acid (ISO) potassium cyanide (ISO) quercetin (ISO) resveratrol (ISO) rotenone (EXP) SB 431542 (ISO) sodium arsenite (ISO) sodium fluoride (ISO) sulforaphane (ISO) sulindac sulfide (ISO) thapsigargin (EXP) titanium dioxide (ISO) tolcapone (EXP) trichloroethene (EXP,ISO) valproic acid (ISO) vancomycin (ISO)
1.
Characterization of the laminin binding domains of the Lutheran blood group glycoprotein.
El Nemer W, etal., J Biol Chem 2001 Jun 29;276(26):23757-62.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
5.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
9.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
Bcam Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 88,542,971 - 88,557,358 (-) NCBI GRCr8 mRatBN7.2 1 79,415,016 - 79,429,403 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 79,415,017 - 79,429,403 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 84,809,588 - 84,823,988 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 93,361,117 - 93,375,464 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 86,564,702 - 86,579,102 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 80,674,463 - 80,689,122 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 80,674,444 - 80,689,171 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 81,939,821 - 81,954,480 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 79,067,352 - 79,081,739 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 79,145,463 - 79,159,850 (-) NCBI Celera 1 73,873,493 - 73,887,880 (-) NCBI Celera Cytogenetic Map 1 q21 NCBI
BCAM Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 44,809,059 - 44,821,421 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 44,809,071 - 44,821,421 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 45,312,316 - 45,324,678 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 50,004,178 - 50,016,518 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 50,004,216 - 50,016,511 NCBI Celera 19 42,115,754 - 42,128,094 (+) NCBI Celera Cytogenetic Map 19 q13.32 NCBI HuRef 19 41,743,446 - 41,755,786 (+) NCBI HuRef CHM1_1 19 45,315,022 - 45,327,384 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 47,633,808 - 47,646,153 (+) NCBI T2T-CHM13v2.0
Bcam Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 19,490,063 - 19,504,457 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 19,490,056 - 19,504,941 (-) Ensembl GRCm39 Ensembl GRCm38 7 19,756,138 - 19,770,532 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 19,756,131 - 19,771,016 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 20,341,487 - 20,355,881 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 18,914,661 - 18,928,997 (-) NCBI MGSCv36 mm8 Celera 7 17,162,318 - 17,178,338 (-) NCBI Celera Cytogenetic Map 7 A3 NCBI cM Map 7 9.94 NCBI
Bcam Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955555 1,942,583 - 1,950,372 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955555 1,943,445 - 1,950,810 (+) NCBI ChiLan1.0 ChiLan1.0
BCAM Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 50,968,108 - 50,980,749 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 52,840,067 - 52,852,703 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 41,756,492 - 41,769,132 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 50,361,780 - 50,374,600 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 50,361,780 - 50,374,600 (+) Ensembl panpan1.1 panPan2
BCAM Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 110,575,883 - 110,585,100 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 110,575,924 - 110,585,035 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 110,056,830 - 110,066,172 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 111,138,698 - 111,148,041 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 111,137,660 - 111,148,040 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 110,780,182 - 110,789,389 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 110,415,767 - 110,425,111 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 111,285,027 - 111,294,370 (-) NCBI UU_Cfam_GSD_1.0
Bcam Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 17,109,872 - 17,118,596 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936706 1,457,174 - 1,467,848 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936706 1,451,609 - 1,465,939 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
BCAM Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 51,298,806 - 51,310,528 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 51,298,743 - 51,310,543 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 47,198,260 - 47,210,371 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BCAM Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 38,288,507 - 38,301,587 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 38,288,537 - 38,301,634 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666073 17,855,578 - 17,868,876 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Bcam
.
Predicted Target Of
Count of predictions: 109 Count of miRNA genes: 77 Interacting mature miRNAs: 92 Transcripts: ENSRNOT00000045574 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1578649 Bmd8 Bone mineral density QTL 8 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 49393172 94393172 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 4889929 Bss87 Bone structure and strength QTL 87 6.7 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 1 53895117 82174945 Rat 2313062 Bmd73 Bone mineral density QTL 73 3.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 11481312 82174945 Rat 8552900 Pigfal1 Plasma insulin-like growth factor 1 level QTL 1 7.4 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 1554320 Bmd1 Bone mineral density QTL 1 12.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 509108 86060548 Rat 2302059 Pia36 Pristane induced arthritis QTL 36 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 43333002 88333002 Rat 2313065 Bss67 Bone structure and strength QTL 67 3.1 0.0001 tibia area (VT:1000281) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 2313069 Bss68 Bone structure and strength QTL 68 2.9 0.0001 tibia size trait (VT:0100001) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 2313075 Bss66 Bone structure and strength QTL 66 3.4 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 11481312 82174945 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 631512 Scl6 Serum cholesterol level QTL 6 9.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 72197680 90508767 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 2313077 Bss69 Bone structure and strength QTL 69 3.5 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 11481312 82174945 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 77876254 106047988 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 1300172 Bp172 Blood pressure QTL 172 3.56 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 32737273 90665040 Rat 4889962 Bss94 Bone structure and strength QTL 94 3.8 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 1 49361465 82174945 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 6903308 Scl36 Serum cholesterol QTL 36 2 0.0125 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 53863041 90532583 Rat 2313092 Bmd72 Bone mineral density QTL 72 2.5 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 11481312 82174945 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 2313097 Bss70 Bone structure and strength QTL 70 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 9589820 Insglur3 Insulin/glucose ratio QTL 3 10.75 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 1 34836858 79836858 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 4889919 Bss86 Bone structure and strength QTL 86 4.1 tibia area (VT:1000281) tibia midshaft total cross-sectional area (CMO:0001715) 1 53895117 82174945 Rat 8552948 Pigfal11 Plasma insulin-like growth factor 1 level QTL 11 4.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 61433 Cia2 Collagen induced arthritis QTL 2 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 78430754 91209302 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000045574 ⟹ ENSRNOP00000047809
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 79,415,017 - 79,429,403 (-) Ensembl Rnor_6.0 Ensembl 1 80,674,444 - 80,689,171 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000098572 ⟹ ENSRNOP00000089177
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 79,415,547 - 79,427,687 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000102437 ⟹ ENSRNOP00000085184
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 79,415,017 - 79,427,860 (-) Ensembl
RefSeq Acc Id:
NM_031752 ⟹ NP_113940
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 88,542,971 - 88,557,358 (-) NCBI mRatBN7.2 1 79,415,016 - 79,429,403 (-) NCBI Rnor_6.0 1 80,674,463 - 80,689,122 (-) NCBI Rnor_5.0 1 81,939,821 - 81,954,480 (-) NCBI RGSC_v3.4 1 79,067,352 - 79,081,739 (-) RGD Celera 1 73,873,493 - 73,887,880 (-) RGD
Sequence:
GCAGGGAATATGGAACCCCCTGACGCCCGCGCAGGGCTACTGTGGCTCACCCTCCTGCTGTCGGGCTACTCAGGTGCCCAGGCTGAGCTGCACGTGTCCGTTCCCCCACGGGTGGAGGTGATGCGAGG
hide sequence
RefSeq Acc Id:
NP_113940 ⟸ NM_031752
- Peptide Label:
precursor
- UniProtKB:
Q9ESS6 (UniProtKB/Swiss-Prot), A0A8I6A1Q0 (UniProtKB/TrEMBL)
- Sequence:
MEPPDARAGLLWLTLLLSGYSGAQAELHVSVPPRVEVMRGEQIALDCTPREHPENYVLEWLLVDASGARHRLASVEPQGSEFLGTIHNSRGRRPPYKIDSLGRLVIAEAQVGDERDYVCVVKAGAAGT
hide sequence
Ensembl Acc Id:
ENSRNOP00000047809 ⟸ ENSRNOT00000045574
Ensembl Acc Id:
ENSRNOP00000089177 ⟸ ENSRNOT00000098572
Ensembl Acc Id:
ENSRNOP00000085184 ⟸ ENSRNOT00000102437
RGD ID: 13689782 Promoter ID: EPDNEW_R307 Type: multiple initiation site Name: Bcam_1 Description: basal cell adhesion molecule SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 80,689,138 - 80,689,198 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-01-14
Bcam
basal cell adhesion molecule (Lutheran blood group)
Bcam
basal cell adhesion molecule
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Bcam
basal cell adhesion molecule
Lu
Lutheran blood group (Auberger b antigen included)
Symbol and Name updated
1299863 APPROVED
2002-06-10
Lu
Lutheran blood group (Auberger b antigen included)
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_product
member of the Ig superfamily
724415
