Advanced Search (OLGA)

Gene: Rab11b (RAB11B, member RAS oncogene family) Rattus norvegicus

Analyze

Symbol:

Rab11b

Name:

RAB11B, member RAS oncogene family

RGD ID:

68369

Description:

Predicted to enable G protein activity; guanyl ribonucleotide binding activity; and myosin V binding activity. Involved in constitutive secretory pathway; regulated exocytosis; and regulation of presynaptic dense core granule exocytosis. Located in synaptic vesicle. Is active in synaptic vesicle membrane. Orthologous to human RAB11B (RAB11B, member RAS oncogene family); PARTICIPATES IN endocytosis pathway; vasopressin signaling pathway via receptor type 2; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 9-cis-retinoic acid; ammonium chloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ras-related protein Rab-11B

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RAB11B (RAB11B, member RAS oncogene family)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rab11b (RAB11B, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rab11b (RAB11B, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RAB11B (RAB11B, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RAB11B (RAB11B, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rab11b (RAB11B, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RAB11B (RAB11B, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RAB11B (RAB11B, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rab11b (RAB11B, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Rab11b (RAB11B, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RAB11A (RAB11A, member RAS oncogene family)	HGNC	OrthoDB
Homo sapiens (human):	IGF1R (insulin like growth factor 1 receptor)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	RAB11B (RAB11B, member RAS oncogene family)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rab11b (RAB11B, member RAS oncogene family)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rab11ba (RAB11B, member RAS oncogene family, a)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	rab11bb (RAB11B, member RAS oncogene family, b)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rab-11.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rab-11.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Rab11	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Rab11	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	YPT31	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	YPT32	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rab11b.2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	rab11b.2	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	rab11b.1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	15,223,613 - 15,236,754 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	15,223,534 - 15,236,756 (-)	Ensembl				GRCr8
mRatBN7.2	7	14,521,448 - 14,534,589 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	14,521,368 - 14,534,593 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	17,530,010 - 17,543,161 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	19,395,243 - 19,408,385 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	17,275,599 - 17,288,744 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	18,598,991 - 18,612,132 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	18,598,880 - 18,612,147 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	18,776,591 - 18,789,732 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	16,232,840 - 16,246,007 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	13,420,039 - 13,433,194 (-)	NCBI		Celera
RGSC_v3.1	7	16,232,842 - 16,246,007 (-)	NCBI
Cytogenetic Map	7	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

human immunodeficiency virus infectious disease (ISO)

Neurodevelopmental Disorder with Ataxic Gait, Absent Speech, and Decreased Cortical White Matter (ISO)

Neurodevelopmental Disorders (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4-hydroxyphenyl retinamide (ISO)

9-cis-retinoic acid (EXP)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

bexarotene (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

butanal (ISO)

Butylbenzyl phthalate (ISO)

cadmium dichloride (ISO)

cannabidiol (ISO)

chlorpyrifos (ISO)

clofibric acid (EXP)

Cuprizon (ISO)

dextran sulfate (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

dicyclanil (ISO)

dioxygen (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

epoxiconazole (ISO)

ethanol (ISO)

flutamide (EXP)

folic acid (ISO)

gamma-tocopherol (ISO)

genistein (ISO)

gentamycin (EXP)

ivermectin (ISO)

methylmercury(1+) (EXP)

mono(2-ethylhexyl) phthalate (ISO)

morphine (ISO)

N-nitrosodiethylamine (EXP)

nefazodone (EXP)

ouabain (ISO)

paracetamol (EXP,ISO)

perfluorohexanesulfonic acid (ISO)

propanal (ISO)

raloxifene (ISO)

resveratrol (ISO)

rotenone (EXP)

selenium atom (ISO)

sodium arsenite (EXP,ISO)

tetrachloromethane (EXP)

theophylline (ISO)

titanium dioxide (ISO)

tocopherol (ISO)

trichloroethene (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

troglitazone (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

amyloid-beta clearance by transcytosis (ISO)

cellular response to acidic pH (ISO,ISS)

constitutive secretory pathway (IBA,IMP,ISO)

endocytic recycling (ISO,ISS)

endocytosis (ISO)

establishment of protein localization to membrane (ISO)

insulin secretion involved in cellular response to glucose stimulus (ISO,ISS)

melanosome transport (ISO,ISS)

protein transport (IEA)

receptor recycling (ISO,ISS)

regulated exocytosis (IBA,IMP,ISO)

regulation of cilium assembly (ISO,ISS)

regulation of endocytic recycling (ISO,ISS)

regulation of monoatomic anion transport (ISO,ISS)

regulation of presynaptic dense core granule exocytosis (IDA,IMP)

regulation of protein localization to cell surface (ISO,ISS)

transferrin transport (ISO,ISS)

Cellular Component

cytoplasm (ISO)

cytoplasmic vesicle (IDA,IEA)

cytoplasmic vesicle membrane (IEA)

Golgi apparatus (IBA)

phagocytic vesicle (IEA,ISO,ISS)

phagocytic vesicle membrane (IEA)

recycling endosome (IBA,ISO,ISS)

recycling endosome membrane (IEA,ISO)

synaptic vesicle (IDA)

synaptic vesicle membrane (EXP,IDA,IEA,IEP)

Molecular Function

G protein activity (IEA,ISO,ISS)

GDP binding (ISO,ISS)

GTP binding (IBA,IEA,ISO,ISS)

GTPase activity (IBA,IEA,ISO,ISS)

hydrolase activity (IEA)

metal ion binding (IEA)

myosin V binding (ISO)

nucleotide binding (IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

endocytosis pathway (IEA)

vasopressin signaling pathway via receptor type 2 (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Divergent functions of neuronal Rab11b in Ca2+-regulated versus constitutive exocytosis.	Khvotchev MV, etal., J Neurosci. 2003 Nov 19;23(33):10531-9.
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	Quantitative analysis of synaptic vesicle Rabs uncovers distinct yet overlapping roles for Rab3a and Rab27b in Ca2+-triggered exocytosis.	Pavlos NJ, etal., J Neurosci. 2010 Oct 6;30(40):13441-53. doi: 10.1523/JNEUROSCI.0907-10.2010.
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
10.	Molecular anatomy of a trafficking organelle.	Takamori S, etal., Cell. 2006 Nov 17;127(4):831-46.
11.	Hidden proteome of synaptic vesicles in the mammalian brain.	Taoufiq Z, etal., Proc Natl Acad Sci U S A. 2020 Dec 29;117(52):33586-33596. doi: 10.1073/pnas.2011870117. Epub 2020 Dec 21.
12.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
13.	Intracellular membrane trafficking pathways in bone-resorbing osteoclasts revealed by cloning and subcellular localization studies of small GTP-binding rab proteins.	Zhao H, etal., Biochem Biophys Res Commun 2002 May 10;293(3):1060-5.

Additional References at PubMed

PMID:10942597	PMID:15489334	PMID:16169070	PMID:16545962	PMID:18614015	PMID:18656450	PMID:19244346	PMID:19335615	PMID:19706553	PMID:20458337	PMID:20717956	PMID:21255211
PMID:21291502	PMID:23376485	PMID:23533145	PMID:23589291	PMID:23612789	PMID:24006491	PMID:24625528	PMID:25468996	PMID:26005850

Genomics

Comparative Map Data

Rab11b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	15,223,613 - 15,236,754 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	15,223,534 - 15,236,756 (-)	Ensembl				GRCr8
mRatBN7.2	7	14,521,448 - 14,534,589 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	14,521,368 - 14,534,593 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	17,530,010 - 17,543,161 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	19,395,243 - 19,408,385 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	17,275,599 - 17,288,744 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	18,598,991 - 18,612,132 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	18,598,880 - 18,612,147 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	18,776,591 - 18,789,732 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	16,232,840 - 16,246,007 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	13,420,039 - 13,433,194 (-)	NCBI		Celera
RGSC_v3.1	7	16,232,842 - 16,246,007 (-)	NCBI
Cytogenetic Map	7	q13	NCBI

RAB11B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	8,390,360 - 8,404,434 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	8,389,981 - 8,405,873 (+)	Ensembl			hg38	GRCh38
GRCh37	19	8,455,244 - 8,469,318 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	8,361,296 - 8,374,479 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	8,361,295 - 8,374,479	NCBI
Celera	19	8,311,860 - 8,325,986 (+)	NCBI		Celera
Cytogenetic Map	19	p13.2	NCBI
HuRef	19	8,108,703 - 8,123,515 (+)	NCBI		HuRef
CHM1_1	19	8,454,661 - 8,468,772 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	8,376,828 - 8,390,915 (+)	NCBI		T2T-CHM13v2.0

Rab11b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	33,961,458 - 33,979,460 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	33,961,458 - 33,979,504 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	17	33,742,484 - 33,760,486 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	33,742,484 - 33,760,530 (-)	Ensembl			mm10	GRCm38
MGSCv37	17	33,879,429 - 33,897,431 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	17	33,353,479 - 33,367,177 (-)	NCBI		MGSCv36	mm8
Celera	17	36,499,813 - 36,517,815 (-)	NCBI		Celera
Cytogenetic Map	17	B1	NCBI
cM Map	17	17.98	NCBI

Rab11b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955563	1,008,769 - 1,017,315 (-)	Ensembl
ChiLan1.0	NW_004955563	1,008,267 - 1,017,315 (-)	NCBI	ChiLan1.0	ChiLan1.0

RAB11B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	13,058,006 - 13,072,108 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	12,174,697 - 12,188,777 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	7,676,095 - 7,690,177 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	8,526,294 - 8,540,147 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2

RAB11B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	52,955,949 - 52,966,279 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	52,956,529 - 52,965,383 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	52,757,255 - 52,768,977 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	53,484,088 - 53,495,852 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	53,484,656 - 53,498,327 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	52,686,120 - 52,697,840 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	53,131,752 - 53,143,468 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	53,363,591 - 53,375,312 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Rab11b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	212,624,348 - 212,636,058 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936588	5,198,394 - 5,214,603 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936588	5,198,659 - 5,210,430 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RAB11B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	70,884,462 - 70,896,172 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	2	70,884,457 - 70,896,169 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	71,251,151 - 71,262,863 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RAB11B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	7,743,130 - 7,757,237 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	7,743,361 - 7,757,305 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666074	12,504,898 - 12,519,218 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rab11b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624828	1,165,327 - 1,174,417 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624828	1,165,877 - 1,174,306 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Rab11b
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	158,664,061 - 158,677,155 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Rab11b
86 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	421
Count of miRNA genes:	207
Interacting mature miRNAs:	234
Transcripts:	ENSRNOT00000010197
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61410	Bw19	Body weight QTL 19	6.2	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	7	1669658	46669658	Rat
1300176	Hrtrt10	Heart rate QTL 10	3.19		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	7	1	23748937	Rat
9590102	Sffal5	Serum free fatty acids level QTL 5	8.62	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	7	7216097	52216097	Rat
1578652	Bmd15	Bone mineral density QTL 15	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	7	10517086	62346019	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	10112916	99900612	Rat
2290372	Gluco33	Glucose level QTL 33	2.71		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	1	31777942	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	1	104117804	Rat
631503	Bp102	Blood pressure QTL 102	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	1709527	46709527	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	1509236	116977875	Rat
9590142	Scort5	Serum corticosterone level QTL 5	24.4	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	1	32612984	Rat
1582260	Bw72	Body weight QTL 72	3.2	0.0043	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	39960528	Rat
1582261	Bw69	Body weight QTL 69	3.2	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	39960528	Rat
1582262	Bw75	Body weight QTL 75	3	0.0038	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	39960528	Rat
2298547	Neuinf5	Neuroinflammation QTL 5	3.7		nervous system integrity trait (VT:0010566)	spinal cord Cd74 protein level (CMO:0002131)	7	10112916	60150541	Rat
10059592	Kidm45	Kidney mass QTL 45	3.95	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	9460877	54460877	Rat
2298550	Neuinf6	Neuroinflammation QTL 6	3.3		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	7	1	29716167	Rat
1300138	Hrtrt9	Heart rate QTL 9	4.72		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	7	10498820	55498820	Rat
724560	Plsm3	Polydactyly-luxate syndrome (PLS) morphotypes QTL 3		0.0003	tibia length (VT:0004357)	tibia length (CMO:0000450)	7	1	34650782	Rat
7411566	Bw136	Body weight QTL 136	10.4	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	1	32612984	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_032617	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF286534	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC062041	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474088	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D01046	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213918	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224922	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226063	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010197 ⟹ ENSRNOP00000010197

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	15,223,534 - 15,236,756 (-)	Ensembl
mRatBN7.2 Ensembl	7	14,521,368 - 14,534,593 (-)	Ensembl
Rnor_6.0 Ensembl	7	18,598,880 - 18,612,147 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000078122 ⟹ ENSRNOP00000071150

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	15,223,534 - 15,236,666 (-)	Ensembl
mRatBN7.2 Ensembl	7	14,521,371 - 14,525,648 (-)	Ensembl
Rnor_6.0 Ensembl	7	18,599,762 - 18,612,118 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114766 ⟹ ENSRNOP00000083984

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	14,521,371 - 14,534,140 (-)	Ensembl

RefSeq Acc Id:

NM_032617 ⟹ NP_116006

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	15,223,613 - 15,236,754 (-)	NCBI
mRatBN7.2	7	14,521,448 - 14,534,589 (-)	NCBI
Rnor_6.0	7	18,598,991 - 18,612,132 (-)	NCBI
Rnor_5.0	7	18,776,591 - 18,789,732 (-)	NCBI
RGSC_v3.4	7	16,232,840 - 16,246,007 (-)	RGD
Celera	7	13,420,039 - 13,433,194 (-)	RGD

Sequence:

show sequence

GTTTGTGGTGGGGCTGCGGAGTCGCCGATCCCGCCGGAAGCGCCAGGACAATGGGGACCCGGGA
CGACGAGTACGATTACCTATTCAAAGTGGTGCTTATTGGGGACTCAGGTGTAGGTAAGAGCAAC
CTGCTGTCACGCTTCACCAGAAACGAGTTCAACCTAGAGAGCAAGAGCACCATTGGAGTGGAGT
TTGCCACTCGCAGCATTCAGGTGGACGGCAAGACCATCAAGGCTCAGATCTGGGATACTGCTGG
CCAGGAGCGCTACCGTGCCATTACCTCTGCGTACTACCGTGGTGCAGTGGGTGCACTGCTGGTA
TATGACATTGCCAAGCACTTGACATATGAGAATGTGGAGCGCTGGCTGAAGGAGCTGCGGGATC
ATGCAGATAGCAACATTGTTATCATGCTGGTGGGCAACAAGAGCGACCTGCGCCATCTTCGGGC
TGTGCCCACTGACGAGGCCCGTGCCTTTGCAGAAAAGAACAACTTGTCCTTCATTGAGACCTCA
GCCTTGGATTCCACCAATGTAGAGGAAGCATTCAAGAACATCCTCACAGAAATCTACCGTATTG
TGTCACAGAAGCAAATTGCTGACCGTGCAGCTCATGATGAGTCCCCTGGCAACAATGTGGTGGA
CATCAGTGTGCCACCCACCACCGATGGACAGAAACCCAATAAGCTGCAGTGCTGCCAGAACCTG
TGACTGCCCTGCACCTCCACCCAGCGTGCGTGCACGTCCTCGGTCCTTGGCCAGCCCCTCACCA
GTGTCCTCCCGGCCCCTCCCTTGTCCCTCTAGGACAGGCTGCTCCCACCCTCCAAGTGAGCTCC
GCCTGCCAGCCCGATGGCCCAGGAAGAGCAGGAGTCCAGTGGCCTCTCCTGTCCTGCCTGCTTG
AGAGAAGCTAGAAGCCCCTTGCTTATGTACCTGCTCTTGGATATTGTGGGCATCTTGACAGGGT
AGGGAGGTTGGTAGGATGGACAGGACCAGCCAGAGGTGAGGAAGATGAGTGGAAGGAGCCGGCT
TCTCCTGTTTTCCATGTCAGACTCCAGGGAGCAATCACCTCCTTCCCTCTCTGGCCAGGTGACC
CAGCTGGCCCTGCATCCCCACCCCAAACCCTCTCTGAGCTGATACCCGAAGAGCCAGGCATCAG
GGGCTGAGCAGGTGGACATTCTGGGCTCTGCCTCCTGCCTACACCACCATAGCCAGCGCCAGCG
CCAGCGCCAGCACGGCCTCCAGCATTCCCAGGCCTGCGCACTCCTGCTCCTGCCTGTAGATTTA
TGCTGGGAGAAGACACCCTTGCCCCCCTCCTTCCTCCTCTGCACGCAGCGCTCTCCTCTGCCCG
TCCCCACTTCTCTTGTCTCGTCTCCTTGTCTGGTCAGGAACCTGTCTGCAAGTGAAGCAATATC
TCCGTGTTTTGTATATACAACTGCTCTTGTAGCCTTTGGTTTTTTGTTATTGTAGAGAAACACA
GATTCTTTATACACTTTGTAAAATTTACGCCAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_116006	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG00542	(Get FASTA)	NCBI Sequence Viewer
	AAH62041	(Get FASTA)	NCBI Sequence Viewer
	BAA22522	(Get FASTA)	NCBI Sequence Viewer
	EDL86622	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010197
GenBank Protein	O35509	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_116006 ⟸ NM_032617

- UniProtKB:

Q9ET14 (UniProtKB/Swiss-Prot), O35509 (UniProtKB/Swiss-Prot), A6KQH9 (UniProtKB/TrEMBL), A0A0G2JZR4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQI
WDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDL
RHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPG
NNVVDISVPPTTDGQKPNKLQCCQNL

hide sequence

Ensembl Acc Id:

ENSRNOP00000071150 ⟸ ENSRNOT00000078122

Ensembl Acc Id:

ENSRNOP00000010197 ⟸ ENSRNOT00000010197

Ensembl Acc Id:

ENSRNOP00000083984 ⟸ ENSRNOT00000114766

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O35509-F1-model_v2	AlphaFold	O35509	1-218	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695098

Promoter ID:

EPDNEW_R5609

Type:

initiation region

Name:

Rab11b_1

Description:

RAB11B, member RAS oncogene family

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	18,612,097 - 18,612,157	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:68369	AgrOrtholog
BioCyc Gene	G2FUF-34711	BioCyc
Ensembl Genes	ENSRNOG00000007648	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000010197	ENTREZGENE
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:5598168	IMAGE-MGC_LOAD
InterPro	P-loop_NTPase	UniProtKB/Swiss-Prot
	Rab_GTPases_membrane_traffic	UniProtKB/Swiss-Prot
	Small_GTP-bd_dom	UniProtKB/Swiss-Prot
	Small_GTPase	UniProtKB/Swiss-Prot
KEGG Report	rno:79434	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72373	IMAGE-MGC_LOAD
NCBI Gene	79434	ENTREZGENE
PANTHER	DRAB11-RELATED	UniProtKB/Swiss-Prot
Pfam	Ras	UniProtKB/Swiss-Prot
PhenoGen	Rab11b	PhenoGen
PRINTS	RASTRNSFRMNG	UniProtKB/Swiss-Prot
PROSITE	RAB	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000007648	RatGTEx
SMART	RAB	UniProtKB/Swiss-Prot
	RAN	UniProtKB/Swiss-Prot
	RAS	UniProtKB/Swiss-Prot
	RHO	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot
TIGR	TC210702
UniProt	A0A0G2JZR4	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2Q4N0_RAT	UniProtKB/TrEMBL
	A6KQH9	ENTREZGENE, UniProtKB/TrEMBL
	O35509	ENTREZGENE
	Q9ET14	ENTREZGENE
	RB11B_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q9ET14	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Rab11b	RAB11B, member RAS oncogene family			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	localized to perinuclear membrane recycling compartments	704352
gene_product	member of the Rab family of small GTP binding proteins	704352

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)