Symbol:
Nr5a1
Name:
nuclear receptor subfamily 5, group A, member 1
RGD ID:
68350
Description:
Enables DNA-binding transcription factor activity; double-stranded DNA binding activity; and sequence-specific DNA binding activity. Involved in several processes, including calcineurin-mediated signaling; positive regulation of male gonad development; and response to gonadotropin-releasing hormone. Predicted to be located in cytosol and nucleoplasm. Predicted to be part of RNA polymerase II transcription regulator complex. Used to study gonadal dysgenesis. Human ortholog(s) of this gene implicated in 46,XX sex reversal 4; 46,XY sex reversal 3; Zellweger syndrome; primary ovarian insufficiency 7; and spermatogenic failure 8. Orthologous to human NR5A1 (nuclear receptor subfamily 5 group A member 1); INTERACTS WITH (S)-nicotine; 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Ad4bp; Ad4BP/SF-1; adrenal 4-binding protein; Ftzf1; fushi tarazu factor homolog 1; nuclear receptor subfamily 5 group A member 1; Sf-1; steroid hormone receptor Ad4BP; steroidogenic factor 1; STF-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NR5A1 (nuclear receptor subfamily 5 group A member 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Nr5a1 (nuclear receptor subfamily 5, group A, member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Nr5a1 (nuclear receptor subfamily 5 group A member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NR5A1 (nuclear receptor subfamily 5 group A member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Nr5a1 (nuclear receptor subfamily 5 group A member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NR5A1 (nuclear receptor subfamily 5 group A member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NR5A1 (nuclear receptor subfamily 5 group A member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Nr5a1 (nuclear receptor subfamily 5 group A member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
NR5A1 (nuclear receptor subfamily 5 group A member 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Nr5a1 (nuclear receptor subfamily 5, group A, member 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
nr5a1a (nuclear receptor subfamily 5, group A, member 1a)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
nr5a1b (nuclear receptor subfamily 5, group A, member 1b)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
nhr-25
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
ftz-f1
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
nr5a1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 42,874,505 - 42,896,109 (-) NCBI GRCr8 mRatBN7.2 3 22,464,786 - 22,486,328 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 22,465,502 - 22,486,328 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 25,933,801 - 25,954,690 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 34,518,798 - 34,539,688 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 32,331,170 - 32,351,980 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 22,998,900 - 23,020,441 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 22,999,616 - 23,020,441 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 28,223,427 - 28,244,968 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 18,498,913 - 18,519,738 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 18,395,933 - 18,412,441 (-) NCBI Celera 3 20,898,726 - 20,919,551 (-) NCBI Celera Cytogenetic Map 3 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nr5a1 Rat (25R)-cholest-5-ene-3beta,26-diol increases activity ISO NR5A1 (Homo sapiens) 6480464 27-hydroxycholesterol results in increased activity of NR5A1 protein CTD PMID:9144161 Nr5a1 Rat (25R)-cholest-5-ene-3beta,26-diol multiple interactions ISO NR5A1 (Homo sapiens) 6480464 27-hydroxycholesterol promotes the reaction [NR5A1 protein results in increased expression of STAR protein] CTD PMID:9804848 Nr5a1 Rat (S)-nicotine decreases expression ISO NR5A1 (Homo sapiens) 6480464 Nicotine results in decreased expression of NR5A1 mRNA and Nicotine results in decreased expression of NR5A1 protein CTD PMID:24709674 Nr5a1 Rat (S)-nicotine multiple interactions ISO NR5A1 (Homo sapiens) 6480464 trichostatin A inhibits the reaction [Nicotine results in decreased expression of NR5A1 mRNA] CTD PMID:24709674 Nr5a1 Rat (S)-nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of NR5A1 mRNA and Nicotine results in decreased expression of NR5A1 protein CTD PMID:24709674 and PMID:28986172 Nr5a1 Rat 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane multiple interactions EXP 6480464 2 more ... CTD PMID:19414516 Nr5a1 Rat 1,2-dimethylhydrazine decreases expression ISO Nr5a1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of NR5A1 mRNA CTD PMID:22206623 Nr5a1 Rat 17alpha-ethynylestradiol multiple interactions ISO Nr5a1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NR5A1 mRNA CTD PMID:17942748 Nr5a1 Rat 17beta-estradiol increases activity ISO NR5A1 (Homo sapiens) 6480464 Estradiol results in increased activity of NR5A1 protein CTD PMID:19549922 Nr5a1 Rat 17beta-estradiol affects expression ISO Nr5a1 (Mus musculus) 6480464 Estradiol affects the expression of NR5A1 mRNA CTD PMID:29092056 Nr5a1 Rat 17beta-estradiol decreases response to substance ISO NR5A1 (Homo sapiens) 6480464 NR5A1 protein results in decreased susceptibility to Estradiol CTD PMID:20045459 Nr5a1 Rat 17beta-estradiol multiple interactions ISO Nr5a1 (Mus musculus) 6480464 [NR5A1 protein co-treated with 8-Bromo Cyclic Adenosine Monophosphate] results in increased abundance of Estradiol CTD PMID:21610156 Nr5a1 Rat 17beta-estradiol multiple interactions ISO NR5A1 (Homo sapiens) 6480464 U 0126 inhibits the reaction [Estradiol results in increased activity of NR5A1 protein] and wortmannin inhibits the reaction [Estradiol results in increased activity of NR5A1 protein] CTD PMID:19549922 Nr5a1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Nr5a1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of NR5A1 mRNA CTD PMID:24058054 Nr5a1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NR5A1 mRNA CTD PMID:16254025 Nr5a1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Nr5a1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NR5A1 mRNA CTD PMID:17942748 Nr5a1 Rat 20-hydroxycholesterol multiple interactions ISO Nr5a1 (Mus musculus) 6480464 [20-hydroxycholesterol co-treated with Tretinoin co-treated with 8-Bromo Cyclic Adenosine Monophosphate] promotes the reaction [NR5A1 protein binds to MC2R promoter] more ... CTD PMID:21610156 Nr5a1 Rat 22-Hydroxycholesterol multiple interactions ISO NR5A1 (Homo sapiens) 6480464 22-hydroxycholesterol promotes the reaction [NR5A1 protein results in increased expression of STAR protein] CTD PMID:9804848 Nr5a1 Rat 25-hydroxycholesterol increases activity ISO NR5A1 (Homo sapiens) 6480464 25-hydroxycholesterol results in increased activity of NR5A1 protein CTD PMID:9144161 Nr5a1 Rat 25-hydroxycholesterol multiple interactions ISO NR5A1 (Homo sapiens) 6480464 25-hydroxycholesterol promotes the reaction [NR5A1 protein results in increased expression of STAR protein] CTD PMID:9804848 Nr5a1 Rat 26-hydroxycholesterol increases activity ISO NR5A1 (Homo sapiens) 6480464 27-hydroxycholesterol results in increased activity of NR5A1 protein CTD PMID:9144161 Nr5a1 Rat 26-hydroxycholesterol multiple interactions ISO NR5A1 (Homo sapiens) 6480464 27-hydroxycholesterol promotes the reaction [NR5A1 protein results in increased expression of STAR protein] CTD PMID:9804848 Nr5a1 Rat 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of NR5A1 mRNA and bisphenol S results in decreased expression of NR5A1 protein CTD PMID:37357847 Nr5a1 Rat 5-aza-2'-deoxycytidine increases expression EXP 6480464 Decitabine results in increased expression of NR5A1 mRNA CTD PMID:28964809 Nr5a1 Rat 5-aza-2'-deoxycytidine multiple interactions EXP 6480464 Decitabine inhibits the reaction [[Genistein co-treated with daidzein co-treated with glycitin co-treated with genistin co-treated with daidzin co-treated with glycitein] results in decreased expression of NR5A1 mRNA] CTD PMID:28964809 Nr5a1 Rat 5-aza-2'-deoxycytidine affects methylation ISO NR5A1 (Homo sapiens) 6480464 Decitabine affects the methylation of NR5A1 promoter CTD PMID:17519303 Nr5a1 Rat 6-propyl-2-thiouracil multiple interactions EXP 6480464 Propylthiouracil promotes the reaction [NR5A1 protein binds to STAR promoter] CTD PMID:20924043 Nr5a1 Rat 6-propyl-2-thiouracil decreases expression ISO Nr5a1 (Mus musculus) 6480464 Propylthiouracil results in decreased expression of NR5A1 protein CTD PMID:29578053 Nr5a1 Rat 8-Br-cAMP multiple interactions ISO Nr5a1 (Mus musculus) 6480464 [20-hydroxycholesterol co-treated with Tretinoin co-treated with 8-Bromo Cyclic Adenosine Monophosphate] promotes the reaction [NR5A1 protein binds to MC2R promoter] more ... CTD PMID:21610156 Nr5a1 Rat aflatoxin B1 decreases methylation ISO NR5A1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of NR5A1 intron CTD PMID:30157460 Nr5a1 Rat all-trans-retinoic acid decreases expression ISO Nr5a1 (Mus musculus) 6480464 Tretinoin results in decreased expression of NR5A1 mRNA CTD PMID:16604517 and PMID:16788091 Nr5a1 Rat all-trans-retinoic acid multiple interactions ISO Nr5a1 (Mus musculus) 6480464 [20-hydroxycholesterol co-treated with Tretinoin co-treated with 8-Bromo Cyclic Adenosine Monophosphate] promotes the reaction [NR5A1 protein binds to MC2R promoter] more ... CTD PMID:21610156 Nr5a1 Rat allethrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] affects the expression of NR5A1 mRNA CTD PMID:33396045 Nr5a1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of NR5A1 mRNA CTD PMID:16483693 Nr5a1 Rat amoxicillin decreases expression ISO Nr5a1 (Mus musculus) 6480464 Amoxicillin results in decreased expression of NR5A1 mRNA CTD PMID:36529298 Nr5a1 Rat antimycin A decreases expression ISO NR5A1 (Homo sapiens) 6480464 Antimycin A results in decreased expression of NR5A1 mRNA CTD PMID:33512557 Nr5a1 Rat aristolochic acid A increases expression ISO NR5A1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of NR5A1 mRNA CTD PMID:33212167 Nr5a1 Rat arsane affects expression EXP 6480464 Arsenic affects the expression of NR5A1 mRNA CTD PMID:36068745 Nr5a1 Rat arsane decreases expression EXP 6480464 Arsenic results in decreased expression of NR5A1 protein CTD PMID:36068745 Nr5a1 Rat arsane affects methylation EXP 6480464 Arsenic affects the methylation of NR5A1 promoter CTD PMID:36068745 Nr5a1 Rat arsenic atom affects expression EXP 6480464 Arsenic affects the expression of NR5A1 mRNA CTD PMID:36068745 Nr5a1 Rat arsenic atom decreases expression EXP 6480464 Arsenic results in decreased expression of NR5A1 protein CTD PMID:36068745 Nr5a1 Rat arsenic atom affects methylation EXP 6480464 Arsenic affects the methylation of NR5A1 promoter CTD PMID:36068745 Nr5a1 Rat atrazine increases phosphorylation ISO NR5A1 (Homo sapiens) 6480464 Atrazine results in increased phosphorylation of NR5A1 protein CTD PMID:18461179 Nr5a1 Rat atrazine increases expression ISO NR5A1 (Homo sapiens) 6480464 Atrazine results in increased expression of NR5A1 mRNA and Atrazine results in increased expression of NR5A1 protein CTD PMID:17520059 and PMID:22378314 Nr5a1 Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of NR5A1 mRNA CTD PMID:19541795 Nr5a1 Rat atrazine affects binding ISO NR5A1 (Homo sapiens) 6480464 Atrazine binds to NR5A1 protein CTD PMID:17520059 Nr5a1 Rat atrazine increases expression EXP 6480464 Atrazine results in increased expression of NR5A1 mRNA CTD PMID:20667998 Nr5a1 Rat atrazine increases activity ISO Nr5a1 (Mus musculus) 6480464 Atrazine results in increased activity of NR5A1 protein CTD PMID:18461179 Nr5a1 Rat atrazine multiple interactions ISO NR5A1 (Homo sapiens) 6480464 Atrazine binds to and results in increased activity of NR5A1 protein more ... CTD PMID:17331471 more ... Nr5a1 Rat azoxystrobin decreases expression ISO NR5A1 (Homo sapiens) 6480464 azoxystrobin results in decreased expression of NR5A1 mRNA CTD PMID:33512557 Nr5a1 Rat bafilomycin A1 decreases expression ISO NR5A1 (Homo sapiens) 6480464 bafilomycin A1 results in decreased expression of NR5A1 protein CTD PMID:29524503 Nr5a1 Rat benzo[a]pyrene multiple interactions ISO Nr5a1 (Mus musculus) 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to NR5A1 promoter] CTD PMID:19654925 Nr5a1 Rat benzo[a]pyrene decreases methylation ISO Nr5a1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of NR5A1 5' UTR more ... CTD PMID:27901495 Nr5a1 Rat benzo[a]pyrene increases methylation ISO NR5A1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of NR5A1 5' UTR CTD PMID:27901495 Nr5a1 Rat benzo[a]pyrene increases expression ISO NR5A1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of NR5A1 mRNA CTD PMID:17520059 Nr5a1 Rat benzo[e]pyrene increases methylation ISO NR5A1 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of NR5A1 intron CTD PMID:30157460 Nr5a1 Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of NR5A1 mRNA CTD PMID:16690193 Nr5a1 Rat bis(2-ethylhexyl) phthalate increases methylation ISO Nr5a1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased methylation of NR5A1 gene CTD PMID:34319233 Nr5a1 Rat bis(2-ethylhexyl) phthalate decreases methylation ISO Nr5a1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased methylation of NR5A1 gene CTD PMID:34319233 Nr5a1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Nr5a1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of NR5A1 mRNA CTD PMID:37812459 Nr5a1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Nr5a1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of NR5A1 mRNA and Diethylhexyl Phthalate results in decreased expression of NR5A1 protein CTD PMID:31175881 more ... Nr5a1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Nr5a1 (Mus musculus) 6480464 icariin inhibits the reaction [Diethylhexyl Phthalate results in decreased expression of NR5A1 mRNA] and icariin inhibits the reaction [Diethylhexyl Phthalate results in decreased expression of NR5A1 protein] CTD PMID:31175881 and PMID:35259346 Nr5a1 Rat bisphenol A decreases expression ISO NR5A1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of NR5A1 mRNA CTD PMID:20064783 Nr5a1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A analog results in decreased expression of NR5A1 mRNA and bisphenol A analog results in decreased expression of NR5A1 protein CTD PMID:35427877 Nr5a1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of NR5A1 gene CTD PMID:28505145 Nr5a1 Rat bisphenol A affects methylation ISO Nr5a1 (Mus musculus) 6480464 bisphenol A affects the methylation of NR5A1 promoter CTD PMID:27334623 Nr5a1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of NR5A1 mRNA CTD PMID:25181051 Nr5a1 Rat bisphenol A decreases expression ISO Nr5a1 (Mus musculus) 6480464 bisphenol A results in decreased expression of NR5A1 mRNA CTD PMID:22875908 and PMID:29092056 Nr5a1 Rat bisphenol A increases expression ISO Nr5a1 (Mus musculus) 6480464 bisphenol A results in increased expression of NR5A1 mRNA CTD PMID:21123812 Nr5a1 Rat Bisphenol B decreases expression EXP 6480464 bisphenol B results in decreased expression of NR5A1 mRNA CTD PMID:33940105 Nr5a1 Rat bucladesine multiple interactions ISO NR5A1 (Homo sapiens) 6480464 Bucladesine inhibits the reaction [CTBP1 protein binds to NR5A1 protein] more ... CTD PMID:18184656 and PMID:35987080 Nr5a1 Rat bucladesine increases expression ISO NR5A1 (Homo sapiens) 6480464 Bucladesine results in increased expression of NR5A1 mRNA and Bucladesine results in increased expression of NR5A1 protein CTD PMID:35987080 Nr5a1 Rat bucladesine multiple interactions ISO Nr5a1 (Mus musculus) 6480464 NR0B1 protein inhibits the reaction [NR5A1 protein promotes the reaction [Bucladesine results in increased expression of STAR mRNA]] and NR5A1 protein promotes the reaction [Bucladesine results in increased expression of STAR mRNA] CTD PMID:18787026 Nr5a1 Rat Butylparaben decreases expression EXP 6480464 butylparaben results in decreased expression of NR5A1 mRNA CTD PMID:27122241 Nr5a1 Rat cadmium atom multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which affects the expression of NR5A1 mRNA and [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of NR5A1 protein CTD PMID:31654709 Nr5a1 Rat cadmium dichloride decreases expression ISO Nr5a1 (Mus musculus) 6480464 Cadmium Chloride results in decreased expression of NR5A1 protein CTD PMID:25786521 Nr5a1 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of NR5A1 mRNA CTD PMID:32497820 Nr5a1 Rat cadmium dichloride multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which affects the expression of NR5A1 mRNA and [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of NR5A1 protein CTD PMID:31654709 Nr5a1 Rat cadmium dichloride multiple interactions ISO Nr5a1 (Mus musculus) 6480464 Cadmium Chloride inhibits the reaction [NR5A1 protein binds to STAR promoter] CTD PMID:25786521 Nr5a1 Rat caffeine decreases expression EXP 6480464 Caffeine results in decreased expression of NR5A1 mRNA and Caffeine results in decreased expression of NR5A1 protein CTD PMID:24717552 Nr5a1 Rat caffeine increases methylation EXP 6480464 Caffeine results in increased methylation of NR5A1 promoter CTD PMID:24717552 Nr5a1 Rat carvacrol multiple interactions EXP 6480464 carvacrol affects the reaction [Streptozocin results in decreased expression of NR5A1 mRNA] and carvacrol affects the reaction [Streptozocin results in decreased expression of NR5A1 protein] CTD PMID:32153207 Nr5a1 Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of NR5A1 mRNA CTD PMID:33586219 and PMID:34060014 Nr5a1 Rat chlorpyrifos multiple interactions EXP 6480464 [iprodione co-treated with Chlorpyrifos] results in decreased expression of NR5A1 mRNA and iprodione promotes the reaction [Chlorpyrifos results in decreased expression of NR5A1 mRNA] CTD PMID:33586219 and PMID:34060014 Nr5a1 Rat chromium(6+) multiple interactions EXP 6480464 Ascorbic Acid inhibits the reaction [chromium hexavalent ion results in decreased expression of NR5A1 mRNA] CTD PMID:18602937 Nr5a1 Rat chromium(6+) decreases expression EXP 6480464 chromium hexavalent ion results in decreased expression of NR5A1 mRNA CTD PMID:18602937 Nr5a1 Rat colforsin daropate hydrochloride affects expression ISO NR5A1 (Homo sapiens) 6480464 Colforsin affects the expression of NR5A1 mRNA CTD PMID:20726872 Nr5a1 Rat copper atom affects expression ISO NR5A1 (Homo sapiens) 6480464 Copper affects the expression of NR5A1 mRNA and Copper affects the expression of NR5A1 protein CTD PMID:34871762 Nr5a1 Rat copper atom decreases methylation ISO NR5A1 (Homo sapiens) 6480464 Copper results in decreased methylation of NR5A1 promoter CTD PMID:34871762 Nr5a1 Rat copper(0) affects expression ISO NR5A1 (Homo sapiens) 6480464 Copper affects the expression of NR5A1 mRNA and Copper affects the expression of NR5A1 protein CTD PMID:34871762 Nr5a1 Rat copper(0) decreases methylation ISO NR5A1 (Homo sapiens) 6480464 Copper results in decreased methylation of NR5A1 promoter CTD PMID:34871762 Nr5a1 Rat crocidolite asbestos increases expression ISO Nr5a1 (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of NR5A1 mRNA CTD PMID:29279043 Nr5a1 Rat cyhalothrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] affects the expression of NR5A1 mRNA CTD PMID:33396045 Nr5a1 Rat cypermethrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] affects the expression of NR5A1 mRNA CTD PMID:33396045 Nr5a1 Rat daidzein multiple interactions EXP 6480464 [Genistein co-treated with daidzein co-treated with glycitin co-treated with genistin co-treated with daidzin co-treated with glycitein] results in decreased expression of NR5A1 mRNA more ... CTD PMID:28964809 Nr5a1 Rat daidzein 7-O-beta-D-glucoside multiple interactions EXP 6480464 [Genistein co-treated with daidzein co-treated with glycitin co-treated with genistin co-treated with daidzin co-treated with glycitein] results in decreased expression of NR5A1 mRNA more ... CTD PMID:28964809 Nr5a1 Rat decabromodiphenyl ether decreases expression ISO Nr5a1 (Mus musculus) 6480464 decabromobiphenyl ether results in decreased expression of NR5A1 mRNA and decabromobiphenyl ether results in decreased expression of NR5A1 protein CTD PMID:26602377 more ... Nr5a1 Rat decabromodiphenyl ether decreases expression ISO NR5A1 (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of NR5A1 mRNA CTD PMID:31326446 Nr5a1 Rat deguelin decreases expression ISO NR5A1 (Homo sapiens) 6480464 deguelin results in decreased expression of NR5A1 mRNA CTD PMID:33512557 Nr5a1 Rat deoxynivalenol decreases expression ISO NR5A1 (Homo sapiens) 6480464 deoxynivalenol results in decreased expression of NR5A1 mRNA CTD PMID:22982764 Nr5a1 Rat dexamethasone multiple interactions ISO NR5A1 (Homo sapiens) 6480464 Dexamethasone promotes the reaction [NR3C1 protein binds to NR5A1 promoter] more ... CTD PMID:35246761 Nr5a1 Rat dexamethasone decreases expression ISO NR5A1 (Homo sapiens) 6480464 Dexamethasone results in decreased expression of NR5A1 mRNA and Dexamethasone results in decreased expression of NR5A1 protein CTD PMID:35246761 Nr5a1 Rat dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of NR5A1 mRNA and Dexamethasone results in decreased expression of NR5A1 protein CTD PMID:35246761 Nr5a1 Rat diazinon increases methylation ISO NR5A1 (Homo sapiens) 6480464 Diazinon results in increased methylation of NR5A1 gene CTD PMID:22964155 Nr5a1 Rat dibutyl phthalate multiple interactions EXP 6480464 Dibutyl Phthalate inhibits the reaction [NR5A1 binds to CYP11A1 promoter] more ... CTD PMID:17884934 and PMID:23358192 Nr5a1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of NR5A1 mRNA and Dibutyl Phthalate results in decreased expression of NR5A1 protein CTD PMID:17379624 more ... Nr5a1 Rat dibutylstannane decreases expression EXP 6480464 di-n-butyltin results in decreased expression of NR5A1 mRNA CTD PMID:33862173 Nr5a1 Rat diethyl hydrogen phosphate increases expression EXP 6480464 diethyl phosphate results in increased expression of NR5A1 mRNA CTD PMID:35777568 Nr5a1 Rat diethyl phthalate multiple interactions EXP 6480464 diethyl phthalate inhibits the reaction [NR5A1 binds to CYP17A1 promoter] and diethyl phthalate inhibits the reaction [NR5A1 binds to STAR promoter] CTD PMID:17884934 Nr5a1 Rat diethylstilbestrol increases expression ISO Nr5a1 (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of NR5A1 mRNA CTD PMID:22100434 Nr5a1 Rat diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of NR5A1 mRNA CTD PMID:37077353 Nr5a1 Rat diisononyl phthalate increases expression ISO Nr5a1 (Mus musculus) 6480464 diisononyl phthalate results in increased expression of NR5A1 mRNA CTD PMID:37812459 Nr5a1 Rat dipentyl phthalate decreases expression EXP 6480464 di-n-pentyl phthalate results in decreased expression of NR5A1 mRNA and di-n-pentyl phthalate results in decreased expression of NR5A1 protein CTD PMID:36715143 Nr5a1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of NR5A1 mRNA CTD PMID:29391264 Nr5a1 Rat ethanol affects expression EXP 6480464 Ethanol affects the expression of NR5A1 mRNA CTD PMID:26188107 Nr5a1 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of NR5A1 mRNA CTD PMID:34454011 Nr5a1 Rat ethanol multiple interactions ISO NR5A1 (Homo sapiens) 6480464 Sirolimus inhibits the reaction [Ethanol results in decreased expression of NR5A1 protein] CTD PMID:29524503 Nr5a1 Rat ethanol decreases expression ISO Nr5a1 (Mus musculus) 6480464 Ethanol results in decreased expression of NR5A1 mRNA CTD PMID:29524503 Nr5a1 Rat ethanol decreases expression ISO NR5A1 (Homo sapiens) 6480464 Ethanol results in decreased expression of NR5A1 mRNA and Ethanol results in decreased expression of NR5A1 protein CTD PMID:29524503 Nr5a1 Rat ethylparaben decreases expression ISO NR5A1 (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in decreased expression of NR5A1 mRNA CTD PMID:37690743 Nr5a1 Rat fenitrothion decreases expression EXP 6480464 Fenitrothion results in decreased expression of NR5A1 mRNA CTD PMID:26264430 Nr5a1 Rat fenitrothion multiple interactions EXP 6480464 Quercetin inhibits the reaction [Fenitrothion results in decreased expression of NR5A1 mRNA] CTD PMID:26264430 Nr5a1 Rat fenpyroximate decreases expression ISO NR5A1 (Homo sapiens) 6480464 fenpyroximate results in decreased expression of NR5A1 mRNA CTD PMID:33512557 Nr5a1 Rat fenvalerate multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] affects the expression of NR5A1 mRNA CTD PMID:33396045 Nr5a1 Rat genistein multiple interactions ISO Nr5a1 (Mus musculus) 6480464 [Genistein co-treated with mono-(2-ethylhexyl)phthalate] results in increased expression of NR5A1 mRNA CTD PMID:27181934 Nr5a1 Rat genistein multiple interactions EXP 6480464 [Genistein co-treated with daidzein co-treated with glycitin co-treated with genistin co-treated with daidzin co-treated with glycitein] results in decreased expression of NR5A1 mRNA more ... CTD PMID:28964809 Nr5a1 Rat genistein 7-O-beta-D-glucoside multiple interactions EXP 6480464 [Genistein co-treated with daidzein co-treated with glycitin co-treated with genistin co-treated with daidzin co-treated with glycitein] results in decreased expression of NR5A1 mRNA more ... CTD PMID:28964809 Nr5a1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of NR5A1 mRNA CTD PMID:33387578 Nr5a1 Rat glycitein multiple interactions EXP 6480464 [Genistein co-treated with daidzein co-treated with glycitin co-treated with genistin co-treated with daidzin co-treated with glycitein] results in decreased expression of NR5A1 mRNA more ... CTD PMID:28964809 Nr5a1 Rat glycitin multiple interactions EXP 6480464 [Genistein co-treated with daidzein co-treated with glycitin co-treated with genistin co-treated with daidzin co-treated with glycitein] results in decreased expression of NR5A1 mRNA more ... CTD PMID:28964809 Nr5a1 Rat icariin multiple interactions ISO Nr5a1 (Mus musculus) 6480464 icariin inhibits the reaction [Diethylhexyl Phthalate results in decreased expression of NR5A1 mRNA] and icariin inhibits the reaction [Diethylhexyl Phthalate results in decreased expression of NR5A1 protein] CTD PMID:31175881 and PMID:35259346 Nr5a1 Rat icariin increases expression ISO Nr5a1 (Mus musculus) 6480464 icariin results in increased expression of NR5A1 mRNA and icariin results in increased expression of NR5A1 protein CTD PMID:31175881 Nr5a1 Rat imidacloprid decreases expression EXP 6480464 imidacloprid results in decreased expression of NR5A1 mRNA CTD PMID:27914857 Nr5a1 Rat iprodione decreases expression EXP 6480464 iprodione results in decreased expression of NR5A1 mRNA CTD PMID:33586219 and PMID:34060014 Nr5a1 Rat iprodione multiple interactions EXP 6480464 [iprodione co-treated with Chlorpyrifos] results in decreased expression of NR5A1 mRNA and iprodione promotes the reaction [Chlorpyrifos results in decreased expression of NR5A1 mRNA] CTD PMID:33586219 and PMID:34060014 Nr5a1 Rat ketoconazole decreases expression EXP 6480464 Ketoconazole results in decreased expression of NR5A1 mRNA CTD PMID:37077353 Nr5a1 Rat L-ascorbic acid multiple interactions EXP 6480464 Ascorbic Acid inhibits the reaction [chromium hexavalent ion results in decreased expression of NR5A1 mRNA] CTD PMID:18602937 Nr5a1 Rat methapyrilene increases methylation ISO NR5A1 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of NR5A1 intron CTD PMID:30157460 Nr5a1 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Nr5a1 (Mus musculus) 6480464 [Genistein co-treated with mono-(2-ethylhexyl)phthalate] results in increased expression of NR5A1 mRNA CTD PMID:27181934 Nr5a1 Rat nicotine decreases expression ISO NR5A1 (Homo sapiens) 6480464 Nicotine results in decreased expression of NR5A1 mRNA and Nicotine results in decreased expression of NR5A1 protein CTD PMID:24709674 Nr5a1 Rat nicotine multiple interactions ISO NR5A1 (Homo sapiens) 6480464 trichostatin A inhibits the reaction [Nicotine results in decreased expression of NR5A1 mRNA] CTD PMID:24709674 Nr5a1 Rat nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of NR5A1 mRNA and Nicotine results in decreased expression of NR5A1 protein CTD PMID:24709674 and PMID:28986172 Nr5a1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of NR5A1 mRNA CTD PMID:33387578 Nr5a1 Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of NR5A1 mRNA and perfluorooctanoic acid results in decreased expression of NR5A1 protein CTD PMID:38050817 Nr5a1 Rat perfluoroundecanoic acid decreases expression EXP 6480464 perfluoroundecanoic acid results in decreased expression of NR5A1 mRNA and perfluoroundecanoic acid results in decreased expression of NR5A1 protein CTD PMID:33549592 Nr5a1 Rat phorbol 13-acetate 12-myristate multiple interactions ISO Nr5a1 (Mus musculus) 6480464 NR0B1 protein inhibits the reaction [NR5A1 protein promotes the reaction [Tetradecanoylphorbol Acetate results in increased expression of STAR mRNA]] and NR5A1 protein promotes the reaction [Tetradecanoylphorbol Acetate results in increased expression of STAR mRNA] CTD PMID:18787026 Nr5a1 Rat picoxystrobin decreases expression ISO NR5A1 (Homo sapiens) 6480464 picoxystrobin results in decreased expression of NR5A1 mRNA CTD PMID:33512557 Nr5a1 Rat proanthocyanidin multiple interactions ISO NR5A1 (Homo sapiens) 6480464 Proanthocyanidins inhibits the reaction [quinocetone metabolite affects the expression of NR5A1 mRNA] CTD PMID:26802905 Nr5a1 Rat progesterone multiple interactions ISO Nr5a1 (Mus musculus) 6480464 [NR5A1 protein co-treated with 20-hydroxycholesterol co-treated with Tretinoin co-treated with 8-Bromo Cyclic Adenosine Monophosphate] results in increased abundance of Progesterone more ... CTD PMID:21610156 Nr5a1 Rat progesterone increases abundance ISO NR5A1 (Homo sapiens) 6480464 NR5A1 protein results in increased abundance of Progesterone CTD PMID:20045459 Nr5a1 Rat prostaglandin E2 multiple interactions ISO NR5A1 (Homo sapiens) 6480464 Dinoprostone promotes the reaction [NR5A1 protein binds to CYP19A1 promoter] and Dinoprostone promotes the reaction [NR5A1 protein binds to STAR promoter] CTD PMID:19001523 Nr5a1 Rat pyruvic acid multiple interactions ISO NR5A1 (Homo sapiens) 6480464 Pyruvic Acid inhibits the reaction [CTBP1 protein binds to NR5A1 protein] and Pyruvic Acid promotes the reaction [NR5A1 protein binds to CYP17A1 promoter] CTD PMID:18184656 Nr5a1 Rat quercetin multiple interactions EXP 6480464 Quercetin inhibits the reaction [Fenitrothion results in decreased expression of NR5A1 mRNA] and Quercetin inhibits the reaction [Zinc Oxide analog results in decreased expression of NR5A1 mRNA] CTD PMID:26264430 and PMID:27111109 Nr5a1 Rat quercetin increases expression EXP 6480464 Quercetin results in increased expression of NR5A1 mRNA CTD PMID:27111109 Nr5a1 Rat resveratrol multiple interactions ISO NR5A1 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of NR5A1 mRNA CTD PMID:23557933 Nr5a1 Rat rotenone decreases expression ISO NR5A1 (Homo sapiens) 6480464 Rotenone results in decreased expression of NR5A1 mRNA CTD PMID:33512557 Nr5a1 Rat simazine increases expression ISO NR5A1 (Homo sapiens) 6480464 Simazine results in increased expression of NR5A1 mRNA CTD PMID:17520059 Nr5a1 Rat sirolimus multiple interactions ISO NR5A1 (Homo sapiens) 6480464 Sirolimus inhibits the reaction [Ethanol results in decreased expression of NR5A1 protein] CTD PMID:29524503 Nr5a1 Rat streptozocin multiple interactions EXP 6480464 carvacrol affects the reaction [Streptozocin results in decreased expression of NR5A1 mRNA] and carvacrol affects the reaction [Streptozocin results in decreased expression of NR5A1 protein] CTD PMID:32153207 Nr5a1 Rat streptozocin decreases expression EXP 6480464 Streptozocin results in decreased expression of NR5A1 mRNA and Streptozocin results in decreased expression of NR5A1 protein CTD PMID:32153207 Nr5a1 Rat T-2 toxin decreases expression ISO NR5A1 (Homo sapiens) 6480464 T-2 Toxin results in decreased expression of NR5A1 mRNA CTD PMID:22982764 Nr5a1 Rat tamoxifen increases activity ISO NR5A1 (Homo sapiens) 6480464 Tamoxifen analog results in increased activity of NR5A1 protein CTD PMID:19549922 Nr5a1 Rat tamoxifen increases phosphorylation ISO NR5A1 (Homo sapiens) 6480464 Tamoxifen analog results in increased phosphorylation of NR5A1 protein CTD PMID:19549922 Nr5a1 Rat tebufenpyrad decreases expression ISO NR5A1 (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of NR5A1 mRNA CTD PMID:33512557 Nr5a1 Rat testosterone increases expression EXP 6480464 Testosterone deficiency results in increased expression of NR5A1 mRNA CTD PMID:8940405 Nr5a1 Rat testosterone multiple interactions ISO Nr5a1 (Mus musculus) 6480464 [NR5A1 protein co-treated with 8-Bromo Cyclic Adenosine Monophosphate] results in increased abundance of Testosterone CTD PMID:21610156 Nr5a1 Rat testosterone multiple interactions EXP 6480464 Testosterone inhibits the reaction [Testosterone deficiency results in increased expression of NR5A1 mRNA] CTD PMID:8940405 Nr5a1 Rat testosterone enanthate decreases expression EXP 6480464 testosterone enanthate results in decreased expression of NR5A1 mRNA CTD PMID:21427060 Nr5a1 Rat Tetrachlorobisphenol A decreases expression ISO NR5A1 (Homo sapiens) 6480464 tetrachlorodian results in decreased expression of NR5A1 mRNA CTD PMID:31326446 Nr5a1 Rat titanium dioxide decreases methylation ISO Nr5a1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of NR5A1 gene CTD PMID:35295148 Nr5a1 Rat titanium dioxide increases methylation ISO Nr5a1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of NR5A1 enhancer CTD PMID:35295148 Nr5a1 Rat triadimefon decreases expression EXP 6480464 triadimefon results in decreased expression of NR5A1 mRNA and triadimefon results in decreased expression of NR5A1 protein CTD PMID:34508824 Nr5a1 Rat tributylstannane decreases expression EXP 6480464 tributyltin results in decreased expression of NR5A1 mRNA and tributyltin results in decreased expression of NR5A1 protein CTD PMID:35430282 Nr5a1 Rat trichostatin A increases expression ISO NR5A1 (Homo sapiens) 6480464 trichostatin A results in increased expression of NR5A1 mRNA CTD PMID:24709674 Nr5a1 Rat trichostatin A multiple interactions ISO NR5A1 (Homo sapiens) 6480464 trichostatin A inhibits the reaction [Nicotine results in decreased expression of NR5A1 mRNA] CTD PMID:24709674 Nr5a1 Rat trimethyltin decreases expression EXP 6480464 trimethyltin results in decreased expression of NR5A1 mRNA and trimethyltin results in decreased expression of NR5A1 protein CTD PMID:32898603 Nr5a1 Rat triphenylstannane decreases expression EXP 6480464 triphenyltin results in decreased expression of NR5A1 mRNA CTD PMID:32504733 and PMID:35489455 Nr5a1 Rat valproic acid increases methylation ISO NR5A1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of NR5A1 gene CTD PMID:29154799 Nr5a1 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of NR5A1 mRNA CTD PMID:18042343 Nr5a1 Rat wortmannin multiple interactions ISO NR5A1 (Homo sapiens) 6480464 wortmannin inhibits the reaction [Estradiol results in increased activity of NR5A1 protein] CTD PMID:19549922 Nr5a1 Rat zearalenone decreases expression EXP 6480464 Zearalenone results in decreased expression of NR5A1 mRNA and Zearalenone results in decreased expression of NR5A1 protein CTD PMID:29669061 Nr5a1 Rat zinc oxide multiple interactions EXP 6480464 Quercetin inhibits the reaction [Zinc Oxide analog results in decreased expression of NR5A1 mRNA] CTD PMID:27111109 Nr5a1 Rat zinc oxide decreases expression EXP 6480464 Zinc Oxide analog results in decreased expression of NR5A1 mRNA CTD PMID:27111109 Nr5a1 Rat ziram decreases expression EXP 6480464 Ziram results in decreased expression of NR5A1 mRNA and Ziram results in decreased expression of NR5A1 protein CTD PMID:28973382 Nr5a1 Rat ziram affects expression EXP 6480464 Ziram affects the expression of NR5A1 mRNA and Ziram affects the expression of NR5A1 protein CTD PMID:29627606
(25R)-cholest-5-ene-3beta,26-diol (ISO) (S)-nicotine (EXP,ISO) 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (EXP) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 20-hydroxycholesterol (ISO) 22-Hydroxycholesterol (ISO) 25-hydroxycholesterol (ISO) 26-hydroxycholesterol (ISO) 4,4'-sulfonyldiphenol (EXP) 5-aza-2'-deoxycytidine (EXP,ISO) 6-propyl-2-thiouracil (EXP,ISO) 8-Br-cAMP (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) allethrin (EXP) ammonium chloride (EXP) amoxicillin (ISO) antimycin A (ISO) aristolochic acid A (ISO) arsane (EXP) arsenic atom (EXP) atrazine (EXP,ISO) azoxystrobin (ISO) bafilomycin A1 (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) Bisphenol B (EXP) bucladesine (ISO) Butylparaben (EXP) cadmium atom (EXP) cadmium dichloride (EXP,ISO) caffeine (EXP) carvacrol (EXP) chlorpyrifos (EXP) chromium(6+) (EXP) colforsin daropate hydrochloride (ISO) copper atom (ISO) copper(0) (ISO) crocidolite asbestos (ISO) cyhalothrin (EXP) cypermethrin (EXP) daidzein (EXP) daidzein 7-O-beta-D-glucoside (EXP) decabromodiphenyl ether (ISO) deguelin (ISO) deoxynivalenol (ISO) dexamethasone (EXP,ISO) diazinon (ISO) dibutyl phthalate (EXP) dibutylstannane (EXP) diethyl hydrogen phosphate (EXP) diethyl phthalate (EXP) diethylstilbestrol (EXP,ISO) diisononyl phthalate (ISO) dipentyl phthalate (EXP) endosulfan (EXP) ethanol (EXP,ISO) ethylparaben (ISO) fenitrothion (EXP) fenpyroximate (ISO) fenvalerate (EXP) genistein (EXP,ISO) genistein 7-O-beta-D-glucoside (EXP) gentamycin (EXP) glycitein (EXP) glycitin (EXP) icariin (ISO) imidacloprid (EXP) iprodione (EXP) ketoconazole (EXP) L-ascorbic acid (EXP) methapyrilene (ISO) mono(2-ethylhexyl) phthalate (ISO) nicotine (EXP,ISO) paracetamol (EXP) perfluorooctanoic acid (EXP) perfluoroundecanoic acid (EXP) phorbol 13-acetate 12-myristate (ISO) picoxystrobin (ISO) proanthocyanidin (ISO) progesterone (ISO) prostaglandin E2 (ISO) pyruvic acid (ISO) quercetin (EXP) resveratrol (ISO) rotenone (ISO) simazine (ISO) sirolimus (ISO) streptozocin (EXP) T-2 toxin (ISO) tamoxifen (ISO) tebufenpyrad (ISO) testosterone (EXP,ISO) testosterone enanthate (EXP) Tetrachlorobisphenol A (ISO) titanium dioxide (ISO) triadimefon (EXP) tributylstannane (EXP) trichostatin A (ISO) trimethyltin (EXP) triphenylstannane (EXP) valproic acid (ISO) vinclozolin (EXP) wortmannin (ISO) zearalenone (EXP) zinc oxide (EXP) ziram (EXP)
Biological Process
adrenal gland development (IEA,ISO) calcineurin-mediated signaling (IMP) female gonad development (IEA,IEP,ISO,ISS) hormone metabolic process (IEA,ISO) hormone-mediated signaling pathway (IBA,IDA) intracellular receptor signaling pathway (IEA) Leydig cell differentiation (IEA,ISO) luteinization (IEA,ISO) maintenance of protein location in nucleus (IEA,ISO) male gonad development (IEA,ISO,ISS) male sex determination (IEA,ISO) negative regulation of female gonad development (IEA,ISO) positive regulation of DNA-templated transcription (IEA,ISO) positive regulation of gene expression (IEA,ISO,ISS) positive regulation of male gonad development (IEA,IMP,ISO) positive regulation of transcription by RNA polymerase II (IEA,ISO) regulation of DNA-templated transcription (IEA,ISO) regulation of transcription by RNA polymerase II (IBA,IEA,ISO) response to gonadotropin-releasing hormone (IEP) Sertoli cell differentiation (IEA,ISO) sex determination (IEA,ISO,ISS) tissue development (IBA,IEA,ISO) transcription by RNA polymerase II (IMP)
Molecular Function
chromatin binding (IEA,ISO) DNA binding (IEA,ISO) DNA-binding transcription factor activity (IEA,IMP) DNA-binding transcription factor activity, RNA polymerase II-specific (IEA,ISO) double-stranded DNA binding (IDA) enzyme binding (IEA,ISO) lipid binding (IEA) metal ion binding (IEA) nuclear receptor activity (IEA,ISO,NAS) phospholipid binding (IEA,ISO) protein binding (ISO) RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IEA,ISO) RNA polymerase II transcription regulatory region sequence-specific DNA binding (IEA,ISO) sequence-specific DNA binding (IDA,IEA,ISO) sequence-specific double-stranded DNA binding (IEA,ISO) transcription coregulator binding (IEA,ISO) zinc ion binding (IEA)
1.
Gonadal determination and adrenal development are regulated by the orphan nuclear receptor steroidogenic factor-1, in a dose-dependent manner.
Achermann JC, etal., J Clin Endocrinol Metab. 2002 Apr;87(4):1829-33.
2.
Differential expression of steroidogenic factor-1 and FTF/LRH-1 in the rodent ovary.
Falender AE, etal., Endocrinology. 2003 Aug;144(8):3598-610.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Transgenic rescue of SF-1-null mice.
Karpova T, etal., Ann N Y Acad Sci. 2005 Dec;1061:55-64.
6.
Calcineurin and CRTC2 mediate FSH and TGFß1 upregulation of Cyp19a1 and Nr5a in ovary granulosa cells.
Lai WA, etal., J Mol Endocrinol. 2014 Oct;53(2):259-70. doi: 10.1530/JME-14-0048. Epub 2014 Jul 23.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
An E box element is required for the expression of the ad4bp gene, a mammalian homologue of ftz-f1 gene, which is essential for adrenal and gonadal development.
Nomura M, etal., J Biol Chem 1995 Mar 31;270(13):7453-61.
10.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
11.
GOA pipeline
RGD automated data pipeline
12.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Genetic and clinical aspects of Zellweger spectrum patients with PEX1 mutations.
Rosewich H, etal., J Med Genet. 2005 Sep;42(9):e58.
15.
Regulation of the orphan nuclear receptor steroidogenic factor 1 by Sox proteins.
Shen JH and Ingraham HA, Mol Endocrinol 2002 Mar;16(3):529-40.
16.
Involvement of cyclic adenosine 5'-monophosphate response element-binding protein, steroidogenic factor 1, and Dax-1 in the regulation of gonadotropin-inducible ovarian transcription factor 1 gene expression by follicle-stimulating hormone in ovarian granulosa cells.
Yazawa T, etal., Endocrinology. 2003 May;144(5):1920-30.
17.
Anterior pituitary gene expression with reproductive aging in the female rat.
Zheng W, etal., Biol Reprod. 2007 Jun;76(6):1091-102. Epub 2007 Mar 7.
Nr5a1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 42,874,505 - 42,896,109 (-) NCBI GRCr8 mRatBN7.2 3 22,464,786 - 22,486,328 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 22,465,502 - 22,486,328 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 25,933,801 - 25,954,690 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 34,518,798 - 34,539,688 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 32,331,170 - 32,351,980 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 22,998,900 - 23,020,441 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 22,999,616 - 23,020,441 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 28,223,427 - 28,244,968 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 18,498,913 - 18,519,738 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 18,395,933 - 18,412,441 (-) NCBI Celera 3 20,898,726 - 20,919,551 (-) NCBI Celera Cytogenetic Map 3 q12 NCBI
NR5A1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 124,481,236 - 124,507,399 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 124,481,236 - 124,507,420 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 127,243,515 - 127,269,678 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 126,283,336 - 126,309,520 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 124,323,069 - 124,349,253 NCBI Celera 9 97,890,732 - 97,916,915 (-) NCBI Celera Cytogenetic Map 9 q33.3 NCBI HuRef 9 96,856,059 - 96,882,213 (-) NCBI HuRef CHM1_1 9 127,392,508 - 127,418,653 (-) NCBI CHM1_1 T2T-CHM13v2.0 9 136,679,465 - 136,705,624 (-) NCBI T2T-CHM13v2.0
Nr5a1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 38,582,668 - 38,604,554 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 38,582,668 - 38,604,554 (-) Ensembl GRCm39 Ensembl GRCm38 2 38,692,656 - 38,714,542 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 38,692,656 - 38,714,542 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 38,548,180 - 38,570,062 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 38,514,636 - 38,536,512 (-) NCBI MGSCv36 mm8 Celera 2 40,416,849 - 40,438,726 (-) NCBI Celera Cytogenetic Map 2 B NCBI cM Map 2 24.42 NCBI
Nr5a1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955419 3,632,220 - 3,654,375 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955419 3,632,248 - 3,654,367 (+) NCBI ChiLan1.0 ChiLan1.0
NR5A1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 14,852,025 - 14,874,137 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 14,854,371 - 14,875,019 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 95,605,282 - 95,628,773 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 124,122,968 - 124,149,292 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 124,122,968 - 124,149,292 (-) Ensembl panpan1.1 panPan2
Nr5a1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 192,970,909 - 193,007,215 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936487 12,739,439 - 12,763,734 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936487 12,739,445 - 12,763,729 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NR5A1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 265,284,493 - 265,311,417 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 265,284,491 - 265,311,547 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 299,123,683 - 299,135,326 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3 Pig Cytomap 1 q210-q211 NCBI
NR5A1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 13,640,453 - 13,666,748 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 13,640,473 - 13,666,863 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666079 2,411,630 - 2,438,042 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Nr5a1
.
Predicted Target Of
Count of predictions: 311 Count of miRNA genes: 182 Interacting mature miRNAs: 219 Transcripts: ENSRNOT00000017651 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1358357 Srcrtb1 Stress Responsive Cort Basal QTL 1 6.36 0.002 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 8658162 27494778 Rat 6893355 Bw101 Body weight QTL 101 0.4 0.38 body mass (VT:0001259) body weight (CMO:0000012) 3 10778704 30357018 Rat 634306 Bp140 Blood pressure QTL 140 3.3 0.0013 arterial blood pressure trait (VT:2000000) body weight (CMO:0000012) 3 17374703 35528639 Rat 10401810 Kidm53 Kidney mass QTL 53 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 8227194 47233430 Rat 1298526 Arunc3 Aerobic running capacity QTL 3 2.2 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 3 8227194 33703538 Rat 8693641 Alc30 Alcohol consumption QTL 30 2 0.739 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 3 10434306 24512004 Rat 2298542 Neuinf11 Neuroinflammation QTL 11 3.9 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 3 15005422 76927699 Rat 1558657 Cm43 Cardiac mass QTL 43 6.6 3e-08 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 10778823 30356773 Rat 631568 Bp92 Blood pressure QTL 92 2.2 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 1 39874793 Rat 6893363 Bw105 Body weight QTL 105 2.6 0.0036 body mass (VT:0001259) body weight (CMO:0000012) 3 10778704 30357018 Rat 61468 Bp15 Blood pressure QTL 15 4.4 blood pressure trait (VT:0000183) pulse pressure (CMO:0000292) 3 1 33278763 Rat 631831 Alc8 Alcohol consumption QTL 8 2.7 consumption behavior trait (VT:0002069) calculated ethanol drink intake rate (CMO:0001615) 3 1 33230976 Rat 1558647 Cm46 Cardiac mass QTL 46 5.4 0.0000055 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 10778823 30356773 Rat 4889966 Bss95 Bone structure and strength QTL 95 4.4 tibia area (VT:1000281) tibia-fibula cross-sectional area (CMO:0001718) 3 1 36847613 Rat 12879852 Cm93 Cardiac mass QTL 93 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 3 18311454 47233430 Rat 1558654 Bw56 Body weight QTL 56 4.5 0.0000171 body mass (VT:0001259) body weight (CMO:0000012) 3 10778704 30357018 Rat 12879853 Am5 Aortic mass QTL 5 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 3 18311454 47233430 Rat 12879854 Kidm63 Kidney mass QTL 63 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 18311454 47233430 Rat 10450804 Scl70 Serum cholesterol level QTL 70 4.7 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 20714090 65714090 Rat 1558650 Cm48 Cardiac mass QTL 48 4 0.0001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 3 10778823 30356773 Rat 1358905 Hrtrt17 Heart rate QTL 17 5.9 0.000014 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 10861912 89878372 Rat 12879849 Bw180 Body weight QTL 180 0.037 body mass (VT:0001259) body weight (CMO:0000012) 3 18311454 47233430 Rat 70191 BpQTLcluster4 Blood pressure QTL cluster 4 3 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 3 10778704 50302886 Rat 12879850 Cm91 Cardiac mass QTL 91 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 3 18311454 47233430 Rat 731172 Bp151 Blood pressure QTL 151 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 18311454 47233430 Rat 12879851 Cm92 Cardiac mass QTL 92 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 18311454 47233430 Rat 631545 Bp85 Blood pressure QTL 85 3.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 1 33278763 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2325840 Bp345 Blood pressure QTL 345 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 18311454 28441896 Rat 631676 Cm8 Cardiac mass QTL 8 7.03 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 3 16954708 61954708 Rat 10450794 Scl69 Serum cholesterol level QTL 69 6.3 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 20714090 65714090 Rat 631679 Cm10 Cardiac mass QTL 10 7.34 0.0001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 1 31158234 Rat 2290452 Scl56 Serum cholesterol level QTL 56 2.26 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 3 1 91609953 Rat 70203 Gcr2 Gastric cancer resistance QTL 2 2.6 stomach morphology trait (VT:0000470) stomach tumor susceptibility score (CMO:0002043) 3 8658162 27494778 Rat 70202 Alc19 Alcohol consumption QTL 19 2.5 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 3 1 27494778 Rat 2312664 Scl62 Serum cholesterol level QTL 62 0.05 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 1 38710544 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat
PMC140651P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 22,480,005 - 22,480,126 (+) MAPPER mRatBN7.2 Rnor_6.0 3 23,014,119 - 23,014,239 NCBI Rnor6.0 Rnor_5.0 3 28,238,646 - 28,238,766 UniSTS Rnor5.0 RGSC_v3.4 3 18,513,416 - 18,513,536 UniSTS RGSC3.4 Celera 3 20,913,229 - 20,913,349 UniSTS Cytogenetic Map 3 q11 UniSTS
RH132410
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 22,464,929 - 22,465,134 (+) MAPPER mRatBN7.2 Rnor_6.0 3 22,999,044 - 22,999,248 NCBI Rnor6.0 Rnor_5.0 3 28,223,571 - 28,223,775 UniSTS Rnor5.0 RGSC_v3.4 3 18,498,341 - 18,498,545 UniSTS RGSC3.4 Celera 3 20,898,154 - 20,898,358 UniSTS RH 3.4 Map 3 213.12 UniSTS Cytogenetic Map 3 q11 UniSTS
UniSTS:464684
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 22,466,078 - 22,466,196 (+) MAPPER mRatBN7.2 Rnor_6.0 3 23,000,192 - 23,000,309 NCBI Rnor6.0 Rnor_5.0 3 28,224,719 - 28,224,836 UniSTS Rnor5.0 RGSC_v3.4 3 18,499,489 - 18,499,606 UniSTS RGSC3.4 Celera 3 20,899,302 - 20,899,419 UniSTS Cytogenetic Map 3 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
6
11
13
100
50
47
21
23
21
6
116
59
80
22
59
26
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000017651 ⟹ ENSRNOP00000017651
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 22,465,502 - 22,486,328 (-) Ensembl Rnor_6.0 Ensembl 3 22,999,616 - 23,020,441 (-) Ensembl
RefSeq Acc Id:
NM_001191099 ⟹ NP_001178028
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 42,875,221 - 42,896,046 (-) NCBI mRatBN7.2 3 22,465,502 - 22,486,328 (-) NCBI Rnor_6.0 3 22,999,616 - 23,020,441 (-) NCBI Rnor_5.0 3 28,223,427 - 28,244,968 (-) NCBI Celera 3 20,898,726 - 20,919,551 (-) NCBI
Sequence:
CCGCTGCTGGGGGAAGAAGTTCCTGACAGCCCGATAGCCACTGCCCTACCTGGGGCCTGGGAACCTCCCCACCAGGACCCTGGTGCCCAGTGTCCACCCTTATCCGGCTGAGAATTCTCCTTCCGTTC
hide sequence
RefSeq Acc Id:
XM_063284685 ⟹ XP_063140755
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 42,874,505 - 42,896,109 (-) NCBI
RefSeq Acc Id:
XM_063284686 ⟹ XP_063140756
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 42,874,505 - 42,893,664 (-) NCBI
RefSeq Acc Id:
XM_063284687 ⟹ XP_063140757
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 42,874,505 - 42,893,644 (-) NCBI
RefSeq Acc Id:
NP_001178028 ⟸ NM_001191099
- UniProtKB:
P50569 (UniProtKB/Swiss-Prot), A6JEU9 (UniProtKB/TrEMBL), A6JEU8 (UniProtKB/TrEMBL)
- Sequence:
MDYSYDEDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKTQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQIRANGFKLETGPPMGV
hide sequence
Ensembl Acc Id:
ENSRNOP00000017651 ⟸ ENSRNOT00000017651
RefSeq Acc Id:
XP_063140755 ⟸ XM_063284685
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063140756 ⟸ XM_063284686
- Peptide Label:
isoform X1
- UniProtKB:
A6JEU8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063140757 ⟸ XM_063284687
- Peptide Label:
isoform X2
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Nr5a1
nuclear receptor subfamily 5, group A, member 1
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_regulation
expression is transcriptionally regulated through an E box element
68249
