Pdlim1 (PDZ and LIM domain 1) - Rat Genome Database

Name: Pdlim1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Pdlim1 (PDZ and LIM domain 1) Rattus norvegicus

Analyze

Symbol:

Pdlim1

Name:

PDZ and LIM domain 1

RGD ID:

68324

Description:

Enables actin binding activity. Involved in several processes, including actin cytoskeleton organization; fibroblast migration; and maintenance of cell polarity. Located in Z disc and stress fiber. Orthologous to human PDLIM1 (PDZ and LIM domain 1); INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

C-terminal LIM domain protein 1; CLP36; elfin; LIM domain protein CLP-36; LIM protein; PDZ and LIM domain 1 (elfin); PDZ and LIM domain protein 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PDLIM1 (PDZ and LIM domain 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Pdlim1 (PDZ and LIM domain 1 (elfin))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pdlim1 (PDZ and LIM domain 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PDLIM1 (PDZ and LIM domain 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PDLIM1 (PDZ and LIM domain 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pdlim1 (PDZ and LIM domain 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PDLIM1 (PDZ and LIM domain 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PDLIM1 (PDZ and LIM domain 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pdlim1 (PDZ and LIM domain 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	KPNA2 (karyopherin subunit alpha 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	PDLIM1 (PDZ and LIM domain 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pdlim1 (PDZ and LIM domain 1 (elfin))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pdlim1 (PDZ and LIM domain 1 (elfin))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Zasp66	Alliance	DIOPT (InParanoid\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	pdlim1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	248,991,818 - 249,040,409 (-)	NCBI		GRCr8
mRatBN7.2	1	239,042,372 - 239,091,074 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	239,042,385 - 239,091,076 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	247,178,448 - 247,226,759 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	253,882,359 - 253,930,342 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	246,535,402 - 246,583,385 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	259,308,326 - 259,357,006 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	259,308,296 - 259,357,056 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	266,752,410 - 266,800,840 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	245,350,086 - 245,399,534 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	245,446,644 - 245,496,093 (-)	NCBI
Celera	1	234,889,852 - 234,937,718 (-)	NCBI		Celera
Cytogenetic Map	1	q54	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,5-hexanedione (EXP)

2,6-dinitrotoluene (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

actinomycin D (ISO)

adefovir pivoxil (ISO)

aflatoxin B1 (EXP)

all-trans-retinoic acid (EXP,ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

atrazine (ISO)

azoxystrobin (EXP)

belinostat (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

bleomycin A2 (EXP)

buspirone (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

cantharidin (ISO)

chloroacetaldehyde (ISO)

chlorpyrifos (EXP)

cidofovir anhydrous (ISO)

cisplatin (ISO)

clodronic acid (ISO)

cobalt dichloride (ISO)

corn oil (EXP)

coumarin (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

dibutyl phthalate (ISO)

dichlorine (EXP)

dioxygen (ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

Enterolactone (ISO)

entinostat (ISO)

enzyme inhibitor (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

fenofibrate (EXP)

folpet (ISO)

fulvestrant (ISO)

fumonisin B1 (ISO)

gamma-hexachlorocyclohexane (EXP)

gamma-linolenic acid (ISO)

glyphosate (EXP)

ibuprofen (EXP,ISO)

imidacloprid (EXP)

indometacin (ISO)

ivermectin (ISO)

lead diacetate (ISO)

lipopolysaccharide (ISO)

mercury dibromide (ISO)

metformin (EXP)

methylmercury chloride (ISO)

N-nitrosodiethylamine (EXP)

N-nitrosomorpholine (EXP)

nefazodone (EXP)

nimesulide (EXP)

Nutlin-3 (ISO)

oxaliplatin (EXP)

ozone (EXP)

panobinostat (ISO)

paracetamol (EXP,ISO)

paraquat (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenformin (EXP)

phenobarbital (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

prednisolone (ISO)

progesterone (ISO)

propiconazole (ISO)

resveratrol (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

Soman (EXP)

sulforaphane (ISO)

sunitinib (ISO)

T-2 toxin (EXP)

tamoxifen (ISO)

tauroursodeoxycholic acid (EXP)

temozolomide (ISO)

tetrachloromethane (EXP,ISO)

thiabendazole (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

trichostatin A (ISO)

triphenyl phosphate (ISO)

Triptolide (EXP)

troglitazone (EXP)

trovafloxacin (EXP)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

actin cytoskeleton organization (IBA,IMP)

establishment or maintenance of actin cytoskeleton polarity (IMP)

fibroblast migration (IMP)

heart development (IBA)

maintenance of cell polarity (IMP)

muscle structure development (IBA)

positive regulation of DNA-templated transcription (IEA)

regulation of transcription by RNA polymerase II (ISO)

response to hypoxia (IEP)

stress fiber assembly (IMP)

Cellular Component

actin cytoskeleton (IDA)

adherens junction (IBA)

cytoplasm (IDA,ISO)

cytoskeleton (ISO)

filamentous actin (IBA)

stress fiber (IBA,IDA,ISO)

transcription regulator complex (ISO)

Z disc (IBA,IDA,ISO)

Molecular Function

actin binding (IBA,IDA)

metal ion binding (IEA)

muscle alpha-actinin binding (IBA)

protein binding (IPI,ISO)

transcription coactivator activity (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	CLP36 and RIL recruit a-actinin-1 to stress fibers and differentially regulate stress fiber dynamics in F2408 fibroblasts.	Miyazaki K, etal., Exp Cell Res. 2012 Aug 15;318(14):1716-25. doi: 10.1016/j.yexcr.2012.05.006. Epub 2012 May 30.
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
9.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
10.	Cloning of a rat cDNA encoding a novel LIM domain protein with high homology to rat RIL.	Wang H, etal., Gene 1995 Nov 20;165(2):267-71.

Additional References at PubMed

PMID:10861853	PMID:11110697	PMID:12464179	PMID:15489334	PMID:17964547	PMID:19780892	PMID:20381583	PMID:20599268	PMID:21423176	PMID:25468996	PMID:38334094

Genomics

Comparative Map Data

Pdlim1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	248,991,818 - 249,040,409 (-)	NCBI		GRCr8
mRatBN7.2	1	239,042,372 - 239,091,074 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	239,042,385 - 239,091,076 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	247,178,448 - 247,226,759 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	253,882,359 - 253,930,342 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	246,535,402 - 246,583,385 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	259,308,326 - 259,357,006 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	259,308,296 - 259,357,056 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	266,752,410 - 266,800,840 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	245,350,086 - 245,399,534 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	245,446,644 - 245,496,093 (-)	NCBI
Celera	1	234,889,852 - 234,937,718 (-)	NCBI		Celera
Cytogenetic Map	1	q54	NCBI

PDLIM1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	95,237,572 - 95,291,003 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	95,237,572 - 95,291,012 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	10	96,997,329 - 97,050,760 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	96,987,319 - 97,040,771 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	10	96,987,321 - 97,040,771	NCBI
Celera	10	90,738,487 - 90,791,969 (-)	NCBI		Celera
Cytogenetic Map	10	q23.33	NCBI
HuRef	10	90,624,265 - 90,677,751 (-)	NCBI		HuRef
CHM1_1	10	97,279,094 - 97,332,709 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	10	96,116,721 - 96,170,181 (-)	NCBI		T2T-CHM13v2.0

Pdlim1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	40,210,683 - 40,260,060 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	40,209,617 - 40,260,286 (-)	Ensembl		GRCm39 Ensembl
GRCm38	19	40,222,239 - 40,271,616 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	40,221,173 - 40,271,842 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	19	40,296,729 - 40,346,106 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	19	40,275,550 - 40,324,844 (-)	NCBI		MGSCv36	mm8
Celera	19	41,028,383 - 41,076,730 (-)	NCBI		Celera
Cytogenetic Map	19	C3	NCBI
cM Map	19	34.24	NCBI

Pdlim1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955507	1,495,925 - 1,523,925 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955507	1,499,223 - 1,525,924 (-)	NCBI	ChiLan1.0	ChiLan1.0

PDLIM1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	107,141,173 - 107,194,647 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	107,146,488 - 107,199,938 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	91,848,127 - 91,901,553 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	95,355,669 - 95,389,838 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	95,355,669 - 95,393,871 (-)	Ensembl	panpan1.1		panPan2

PDLIM1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	28	8,770,882 - 8,817,828 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	28	8,771,186 - 8,801,354 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	28	8,947,047 - 8,994,090 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	28	9,033,997 - 9,079,972 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	28	9,033,997 - 9,079,973 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	28	8,749,916 - 8,797,044 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	28	8,808,695 - 8,855,890 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	28	8,952,472 - 8,999,504 (-)	NCBI		UU_Cfam_GSD_1.0

Pdlim1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	38,044,314 - 38,087,612 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936636	4,083,071 - 4,126,739 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936636	4,083,413 - 4,126,728 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PDLIM1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	106,735,500 - 106,794,065 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	106,744,320 - 106,793,606 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	116,377,059 - 116,426,077 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PDLIM1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	88,398,814 - 88,452,660 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	88,397,294 - 88,452,610 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	49,270,732 - 49,324,931 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pdlim1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624737	6,485,607 - 6,530,526 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624737	6,485,607 - 6,530,511 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Pdlim1
301 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	298
Count of miRNA genes:	190
Interacting mature miRNAs:	213
Transcripts:	ENSRNOT00000022000
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
631690	Scl5	Serum cholesterol level QTL 5	2.1		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	236125214	260522016	Rat
1357335	Bw39	Body weight QTL 39	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	1	197814409	242814409	Rat
2302375	Bw83	Body weight QTL 83	4.87	0.0002	body mass (VT:0001259)	body weight (CMO:0000012)	1	197697768	242697768	Rat
2293674	Bss39	Bone structure and strength QTL 39	7.1	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	1	201554356	246554356	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	177227632	256448636	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
61327	Eae7	Experimental allergic encephalomyelitis QTL 7	5.6		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	216255568	260522016	Rat
1600392	Bw123	Body weight QTL 123		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	223201027	260522016	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	195804352	257091168	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
631837	Niddm35	Non-insulin dependent diabetes mellitus QTL 35		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	238699859	259647894	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	177227632	256448636	Rat
631836	Stl31	Serum triglyceride level QTL 31	4.64	5e-06	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	237147813	260522016	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	206081677	251081677	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
2293694	Bss38	Bone structure and strength QTL 38	7.05	0.0001	femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	1	201554356	246554356	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	123556856	242907031	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
1300108	Rf8	Renal function QTL 8	3.75		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	1	228581588	259647894	Rat
8655655	Arrd2	Age-related retinal degeneration QTL 2	7.79		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	183970203	243914901	Rat
734767	Niddm57	Non-insulin dependent diabetes mellitus QTL 57			body mass (VT:0001259)	body weight (CMO:0000012)	1	224054293	260122809	Rat
631215	Stl8	Serum triglyceride level QTL 8	9.27	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	1	225126575	260522016	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	191019702	246062233	Rat
631843	Bw116	Body weight QTL 116	4.1	0.016	abdominal adipose amount (VT:1000220)	abdominal fat pad weight (CMO:0000088)	1	224054293	260122809	Rat
731175	Uae20	Urinary albumin excretion QTL 20	3.5	0.0018	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	221264111	259647894	Rat
2300175	Bmd40	Bone mineral density QTL 40	15.4	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	1	201554356	246554356	Rat
724538	Kidm1	Kidney mass QTL 1	3.2		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	213707201	252085212	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
2293655	Bss36	Bone structure and strength QTL 36	10.66	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	201554356	246554356	Rat
1298084	Thym4	Thymus enlargement QTL 4	10.68		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	197814409	242814409	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
734769	Niddm58	Non-insulin dependent diabetes mellitus QTL 58			body mass (VT:0001259)	body weight (CMO:0000012)	1	224569538	260122809	Rat
734768	Niddm59	Non-insulin dependent diabetes mellitus QTL 59			body mass (VT:0001259)	body weight (CMO:0000012)	1	213843987	258843987	Rat
724533	Rf51	Renal function QTL 51	5.3	0.0002	kidney plasma flow trait (VT:0005524)	renal plasma flow (CMO:0001914)	1	218753816	256448513	Rat
1358890	Bp259	Blood pressure QTL 259	3.06		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	210702053	260522016	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	199050459	259647894	Rat
1358292	Cm37	Cardiac mass QTL 37	6.2	8e-07	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	1	196248093	241248093	Rat
61376	Bp42	Blood pressure QTL 42	23.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	197814409	242814409	Rat
1549910	Bw54	Body weight QTL 54		0.05	body mass (VT:0001259)	body weight (CMO:0000012)	1	214647894	259647894	Rat
70211	Niddm24	Non-insulin dependent diabetes mellitus QTL 24	3.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	214647894	259647894	Rat
724552	Glom2	Glomerulus QTL 2	3.3	0.0001	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	1	222363780	260522016	Rat
1357399	Bw45	Body weight QTL 45	3.05		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	1	206329708	251329708	Rat
2316896	Gluco57	Glucose level QTL 57	7.2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	228985440	245907899	Rat
1357404	Bw42	Body weight QTL 42	4.49	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	1	206329708	251329708	Rat
10053715	Scort24	Serum corticosterone level QTL 24	2.13	0.0088	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	221414816	260522016	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
1358916	Kidm22	Kidney mass QTL 22	3.32		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	210702053	240947965	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	178810256	240830002	Rat
61400	Niddm1	Non-insulin dependent diabetes mellitus QTL 1	11		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	218753689	245907899	Rat
2292216	Bw80	Body weight QTL 80	3.23	0.0019	body mass (VT:0001259)	body weight (CMO:0000012)	1	213533809	243914901	Rat
10059587	Bw173	Body weight QTL 173	3.23	0.025	body mass (VT:0001259)	body weight (CMO:0000012)	1	202069611	247069611	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	243914901	Rat
631658	Cm7	Cardiac mass QTL 7	5.32	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	1	196248093	241248093	Rat
2293700	Bmd27	Bone mineral density QTL 27	6.6	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	224054293	243747962	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
2293701	Bmd34	Bone mineral density QTL 34	8.3	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	1	224054293	243747962	Rat
7387289	Uae45	Urinary albumin excretion QTL 45	2.86	0.0021	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	223262787	260522016	Rat
8655855	Arrd3	Age-related retinal degeneration QTL 3	3.07		lens clarity trait (VT:0001304)	cataract incidence/prevalence measurement (CMO:0001585)	1	183970203	243914901	Rat
1600374	Mcs17	Mammary carcinoma susceptibility QTL 17	3		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	197670404	242670404	Rat
1581544	Rf52	Renal function QTL 52		0.05	urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	1	232156370	259647894	Rat
1600363	Hc6	Hypercalciuria QTL 6	2.7		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	203995416	244113296	Rat
631536	Lnnr2	Liver neoplastic nodule remodeling QTL 2	2.9	0.0005	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	1	233948574	260522016	Rat
2302040	Pia35	Pristane induced arthritis QTL 35	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	216255568	260522016	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	176426412	257976495	Rat
1358191	Ept10	Estrogen-induced pituitary tumorigenesis QTL 10	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	192825253	243914732	Rat
631669	Iddm9	Insulin dependent diabetes mellitus QTL 9	2.8	0.039	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	233190394	258625266	Rat
1598821	Rf55	Renal function QTL 55	6.3		renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	218748008	257976495	Rat
7394701	Uae46	Urinary albumin excretion QTL 46	3.6	0.0056	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	201554356	246554356	Rat

Markers in Region

AI029470

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	239,042,435 - 239,042,653 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	259,308,388 - 259,308,605	NCBI	Rnor6.0
Rnor_5.0	1	266,752,472 - 266,752,689	UniSTS	Rnor5.0
RGSC_v3.4	1	245,350,148 - 245,350,365	UniSTS	RGSC3.4
Celera	1	234,889,914 - 234,890,131	UniSTS
RH 3.4 Map	1	1619.02	UniSTS
Cytogenetic Map	1	q53	UniSTS

BE108553

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	239,085,522 - 239,085,690 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	259,351,561 - 259,351,728	NCBI	Rnor6.0
Rnor_5.0	1	266,795,395 - 266,795,562	UniSTS	Rnor5.0
RGSC_v3.4	1	245,394,089 - 245,394,256	UniSTS	RGSC3.4
Celera	1	234,932,277 - 234,932,444	UniSTS
RH 3.4 Map	1	1618.9	UniSTS
Cytogenetic Map	1	q53	UniSTS

AU047677

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	239,086,072 - 239,086,202 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	259,352,111 - 259,352,240	NCBI	Rnor6.0
Rnor_5.0	1	266,795,945 - 266,796,074	UniSTS	Rnor5.0
RGSC_v3.4	1	245,394,639 - 245,394,768	UniSTS	RGSC3.4
Celera	1	234,932,827 - 234,932,956	UniSTS
Cytogenetic Map	1	q53	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017365	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC128172	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC072465	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473986	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214797	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227333	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U23769	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000022000 ⟹ ENSRNOP00000022000

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	239,042,385 - 239,091,076 (-)	Ensembl
Rnor_6.0 Ensembl	1	259,308,296 - 259,357,056 (-)	Ensembl

RefSeq Acc Id:

NM_017365 ⟹ NP_059061

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	248,991,818 - 249,040,409 (-)	NCBI
mRatBN7.2	1	239,042,374 - 239,090,968 (-)	NCBI
Rnor_6.0	1	259,308,326 - 259,357,006 (-)	NCBI
Rnor_5.0	1	266,752,410 - 266,800,840 (-)	NCBI
RGSC_v3.4	1	245,350,086 - 245,399,534 (-)	RGD
Celera	1	234,889,852 - 234,937,718 (-)	RGD

Sequence:

show sequence

CCGGGATCCCTGCGCGCCGTGGTGTTCTGTGCCTTGCCGGTCTGTTCCCTCCGATTGTGCCTAG
CAATGACCACCCAGCAGATTGTTCTCCAGGGCCCGGGACCCTGGGGTTTCCGACTCGTGGGCGG
CAAGGACTTTGAGCAACCTCTCGCCATTTCCCGGGTCACTCCCGGGAGCAAGGCTGCTATAGCT
AACTTATGCATAGGAGATTTGATCACAGCCATTGATGGGGAAGATACCAGCAGTATGACACACT
TGGAAGCTCAGAACAAAATCAAGGGCTGCGTAGACAACATGACGCTCACAGTATCCAGGTCTGA
GCAGAAGATTTGGTCTCCTCTAGTGACCGAGGAGGGGAAACGTCACCCCTACAAGATGAATTTA
GCGTCGGAACCCCAAGAAGTCCTGCACATCGGAAGTGCCCACAACCGTAGTGCTATGCCATTTA
CCGCCTCACCTGCTCCTGGCACCCGGGTCATCACAAACCAGTACAACAGCCCTACCGGCCTCTA
CTCATCTGAAAACATCTCTAACTTCAACAATGCAGTGGAGTCAAAGACCTCAGCCAGTGGGGAG
GAGGCGAACAGCAGGCCCTCGGCTCAGCCTCATCCCTCCGGCGGCCTTATCATCGACAAGGAAT
CCGAAGTTTACAAGATGCTTCAGGAGAAGCAAGAGTTAAACGAGCCCCCCAAACAGTCCACATC
ATTCCTGGTTCTGCAGGAGATCCTGGAGTCGGATGGGAAAGGGGACCCCAACAAGCCATCAGGA
TTTAGAAGTGTTAAAGCTCCAGTCACCAAAGTGGCTGCATCTGTTGGAAATGCTCAGAAGCTGC
CCATCTGTGACAAATGTGGAACCGGCATTGTTGGTGTGTTTGTGAAGCTGAGGGACCATCATCC
CCACCCTGAATGTTATGTGTGCACCGACTGTGGCATCAACCTGAAACAGAAGGGCCATTTCTTT
GTAGGGGATCAGATTTATTGTGAAAAGCATGCCCGGGAGAGGGTCACACCACCTGAGGGCTATG
ATGTGGTCACAGTGTTCCCCAAGTGATCGAGAGGACCTGCCCTGTCTGCTGCCCTCCAGCCTGC
CTGCTGCACCTGGTTGTCAGAATGTTCTGGTTCTCTCCTCCCTGACAGTCCTGTGCTTAGTGTT
AGTCCTGCTCAGTAAACATTGAGTTTCTCCTGTACTGACTGACCCTGACTGGCAGTGTGACACC
TGCTTTTACATTACCGGGAGGTGGTTTTGTCCCTGTCCCCTCACCCACACCACAATGCACCTTC
TTCCCTTGGAGTCTTCCCTGCTGAAAATGGACATTGGTCACATTGGAATTAAGCCAAATGTTTT
ATCTCTGATGTTACTTTGTTTTACTTAATAAATTTAGACTTTAAAGC

hide sequence

Protein Sequences


Protein RefSeqs	NP_059061	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA92046	(Get FASTA)	NCBI Sequence Viewer
	AAH72465	(Get FASTA)	NCBI Sequence Viewer
	EDL94180	(Get FASTA)	NCBI Sequence Viewer
	EDL94181	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000022000.1
	ENSRNOP00055041236
	ENSRNOP00060038336
	ENSRNOP00065042843
GenBank Protein	P52944	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_059061 ⟸ NM_017365

- UniProtKB:

Q6IN45 (UniProtKB/Swiss-Prot), P52944 (UniProtKB/Swiss-Prot), A6JH56 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTTQQIVLQGPGPWGFRLVGGKDFEQPLAISRVTPGSKAAIANLCIGDLITAIDGEDTSSMTHL
EAQNKIKGCVDNMTLTVSRSEQKIWSPLVTEEGKRHPYKMNLASEPQEVLHIGSAHNRSAMPFT
ASPAPGTRVITNQYNSPTGLYSSENISNFNNAVESKTSASGEEANSRPSAQPHPSGGLIIDKES
EVYKMLQEKQELNEPPKQSTSFLVLQEILESDGKGDPNKPSGFRSVKAPVTKVAASVGNAQKLP
ICDKCGTGIVGVFVKLRDHHPHPECYVCTDCGINLKQKGHFFVGDQIYCEKHARERVTPPEGYD
VVTVFPK

hide sequence

Ensembl Acc Id:

ENSRNOP00000022000 ⟸ ENSRNOT00000022000

Protein Domains

LIM zinc-binding PDZ

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P52944-F1-model_v2	AlphaFold	P52944	1-327	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690896

Promoter ID:

EPDNEW_R1421

Type:

initiation region

Name:

Pdlim1_1

Description:

PDZ and LIM domain 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	259,357,013 - 259,357,073	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:68324	AgrOrtholog
BioCyc Gene	G2FUF-55720	BioCyc
Ensembl Genes	ENSRNOG00000016166	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00055028920	UniProtKB/Swiss-Prot
	ENSRNOG00060026649	UniProtKB/Swiss-Prot
	ENSRNOG00065030159	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000022000.5	UniProtKB/Swiss-Prot
	ENSRNOT00055050082	UniProtKB/Swiss-Prot
	ENSRNOT00060046151	UniProtKB/Swiss-Prot
	ENSRNOT00065052054	UniProtKB/Swiss-Prot
Gene3D-CATH	2.30.42.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Cysteine Rich Protein	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7100446	IMAGE-MGC_LOAD
InterPro	DUF4749	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PDLIM1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PDZ	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PDZ-LIM_domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PDZ_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Zasp-like_motif	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Znf_LIM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:54133	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:91751	IMAGE-MGC_LOAD
NCBI Gene	Pdlim1	ENTREZGENE
PANTHER	PDZ AND LIM DOMAIN PROTEIN 1	UniProtKB/TrEMBL
	PDZ AND LIM DOMAIN PROTEIN ZASP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR24214:SF5	UniProtKB/Swiss-Prot
Pfam	DUF4749	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	LIM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PDZ	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Pdlim1	PhenoGen
PROSITE	LIM_DOMAIN_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	LIM_DOMAIN_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PDZ	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000016166	RatGTEx
	ENSRNOG00055028920	RatGTEx
	ENSRNOG00060026649	RatGTEx
	ENSRNOG00065030159	RatGTEx
SMART	LIM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PDZ	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SM00735	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Glucocorticoid receptor-like (DNA-binding domain)	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PDZ domain-like	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
TIGR	TC205375
UniProt	A6JH56	ENTREZGENE, UniProtKB/TrEMBL
	A6JH57_RAT	UniProtKB/TrEMBL
	P52944	ENTREZGENE, UniProtKB/Swiss-Prot
	Q6IN45	ENTREZGENE
UniProt Secondary	Q6IN45	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2009-02-26	Pdlim1	PDZ and LIM domain 1	Pdlim1	PDZ and LIM domain 1 (elfin)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Pdlim1	PDZ and LIM domain 1 (elfin)		PDZ and LIM domain 1	Name updated	1299863	APPROVED
2002-06-10	Pdlim1	PDZ and LIM domain 1			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	decreased mRNA expression occurs in response to chemical hypoxia	68225

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message