Symbol:
Pdlim1
Name:
PDZ and LIM domain 1
RGD ID:
68324
Description:
Enables actin binding activity. Involved in several processes, including actin cytoskeleton organization; fibroblast migration; and maintenance of cell polarity. Located in Z disc and stress fiber. Orthologous to human PDLIM1 (PDZ and LIM domain 1); INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
C-terminal LIM domain protein 1; CLP36; elfin; LIM domain protein CLP-36; LIM protein; PDZ and LIM domain 1 (elfin); PDZ and LIM domain protein 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PDLIM1 (PDZ and LIM domain 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Pdlim1 (PDZ and LIM domain 1 (elfin)) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pdlim1 (PDZ and LIM domain 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PDLIM1 (PDZ and LIM domain 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PDLIM1 (PDZ and LIM domain 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pdlim1 (PDZ and LIM domain 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PDLIM1 (PDZ and LIM domain 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PDLIM1 (PDZ and LIM domain 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pdlim1 (PDZ and LIM domain 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
KPNA2 (karyopherin subunit alpha 2) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
PDLIM1 (PDZ and LIM domain 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Pdlim1 (PDZ and LIM domain 1 (elfin))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
pdlim1 (PDZ and LIM domain 1 (elfin))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Zasp66
Alliance
DIOPT (InParanoid|PANTHER)
Xenopus tropicalis (tropical clawed frog):
pdlim1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 248,991,818 - 249,040,409 (-) NCBI GRCr8 mRatBN7.2 1 239,042,372 - 239,091,074 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 239,042,385 - 239,091,076 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 247,178,448 - 247,226,759 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 253,882,359 - 253,930,342 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 246,535,402 - 246,583,385 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 259,308,326 - 259,357,006 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 259,308,296 - 259,357,056 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 266,752,410 - 266,800,840 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 245,350,086 - 245,399,534 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 245,446,644 - 245,496,093 (-) NCBI Celera 1 234,889,852 - 234,937,718 (-) NCBI Celera Cytogenetic Map 1 q54 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pdlim1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of PDLIM1 mRNA] CTD PMID:31150632 Pdlim1 Rat (1->4)-beta-D-glucan multiple interactions ISO Pdlim1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PDLIM1 mRNA CTD PMID:36331819 Pdlim1 Rat 1,1-dichloroethene increases expression ISO Pdlim1 (Mus musculus) 6480464 vinylidene chloride results in increased expression of PDLIM1 mRNA CTD PMID:26682919 Pdlim1 Rat 1,2-dimethylhydrazine decreases expression ISO Pdlim1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of PDLIM1 mRNA CTD PMID:22206623 Pdlim1 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of PDLIM1 mRNA CTD PMID:30723492 Pdlim1 Rat 17alpha-ethynylestradiol affects expression ISO Pdlim1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of PDLIM1 mRNA CTD PMID:17555576 Pdlim1 Rat 17alpha-ethynylestradiol multiple interactions ISO Pdlim1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PDLIM1 mRNA CTD PMID:17942748 Pdlim1 Rat 17alpha-ethynylestradiol increases expression ISO Pdlim1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of PDLIM1 mRNA CTD PMID:17942748 Pdlim1 Rat 17beta-estradiol decreases expression ISO PDLIM1 (Homo sapiens) 6480464 Estradiol results in decreased expression of PDLIM1 mRNA CTD PMID:19167446 Pdlim1 Rat 17beta-estradiol increases expression ISO Pdlim1 (Mus musculus) 6480464 Estradiol results in increased expression of PDLIM1 mRNA CTD PMID:39298647 Pdlim1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Pdlim1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PDLIM1 mRNA CTD PMID:17942748 Pdlim1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PDLIM1 mRNA CTD PMID:33387578 Pdlim1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PDLIM1 mRNA CTD PMID:34747641 Pdlim1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Pdlim1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PDLIM1 mRNA CTD PMID:21570461 Pdlim1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PDLIM1 mRNA CTD PMID:21215274 Pdlim1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 AHR protein alternative form affects the reaction [Tetrachlorodibenzodioxin results in decreased expression of PDLIM1 mRNA] CTD PMID:21215274 Pdlim1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Pdlim1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PDLIM1 mRNA CTD PMID:17942748 Pdlim1 Rat 2,5-hexanedione increases expression EXP 6480464 2 and 5-hexanedione results in increased expression of PDLIM1 protein CTD PMID:15928459 Pdlim1 Rat 2,6-dimethoxyphenol multiple interactions ISO PDLIM1 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Pdlim1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of PDLIM1 mRNA CTD PMID:21346803 Pdlim1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO PDLIM1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PDLIM1 mRNA more ... CTD PMID:28628672 Pdlim1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO PDLIM1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of PDLIM1 mRNA CTD PMID:28628672 Pdlim1 Rat 4,4'-sulfonyldiphenol increases expression ISO PDLIM1 (Homo sapiens) 6480464 bisphenol S results in increased expression of PDLIM1 protein CTD PMID:34186270 Pdlim1 Rat 4,4'-sulfonyldiphenol increases expression ISO Pdlim1 (Mus musculus) 6480464 bisphenol S results in increased expression of PDLIM1 mRNA CTD PMID:30951980 and PMID:39298647 Pdlim1 Rat 4-hydroxyphenyl retinamide increases expression ISO Pdlim1 (Mus musculus) 6480464 Fenretinide results in increased expression of PDLIM1 mRNA CTD PMID:28973697 Pdlim1 Rat 5-aza-2'-deoxycytidine affects expression ISO PDLIM1 (Homo sapiens) 6480464 Decitabine affects the expression of PDLIM1 mRNA CTD PMID:23300844 Pdlim1 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of PDLIM1 mRNA CTD PMID:24780913 Pdlim1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of PDLIM1 mRNA CTD PMID:31881176 Pdlim1 Rat actinomycin D multiple interactions ISO PDLIM1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of PDLIM1 protein CTD PMID:38460933 Pdlim1 Rat adefovir pivoxil increases expression ISO PDLIM1 (Homo sapiens) 6480464 adefovir dipivoxil results in increased expression of PDLIM1 mRNA CTD PMID:25596134 Pdlim1 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of PDLIM1 mRNA CTD PMID:33354967 Pdlim1 Rat all-trans-retinoic acid increases expression ISO PDLIM1 (Homo sapiens) 6480464 Tretinoin results in increased expression of PDLIM1 mRNA CTD PMID:21934132 Pdlim1 Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of PDLIM1 mRNA CTD PMID:20488242 Pdlim1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PDLIM1 mRNA CTD PMID:16483693 Pdlim1 Rat aristolochic acid A decreases expression ISO PDLIM1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of PDLIM1 mRNA CTD PMID:33212167 Pdlim1 Rat arsane affects methylation ISO PDLIM1 (Homo sapiens) 6480464 Arsenic affects the methylation of PDLIM1 gene CTD PMID:25304211 Pdlim1 Rat arsenic atom affects methylation ISO PDLIM1 (Homo sapiens) 6480464 Arsenic affects the methylation of PDLIM1 gene CTD PMID:25304211 Pdlim1 Rat atrazine increases expression ISO PDLIM1 (Homo sapiens) 6480464 Atrazine results in increased expression of PDLIM1 mRNA CTD PMID:22378314 Pdlim1 Rat azoxystrobin multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of PDLIM1 mRNA CTD PMID:33854195 Pdlim1 Rat belinostat multiple interactions ISO PDLIM1 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PDLIM1 mRNA CTD PMID:27188386 Pdlim1 Rat belinostat increases expression ISO PDLIM1 (Homo sapiens) 6480464 belinostat results in increased expression of PDLIM1 mRNA CTD PMID:26272509 Pdlim1 Rat benzo[a]pyrene decreases expression ISO Pdlim1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of PDLIM1 mRNA CTD PMID:19770486 Pdlim1 Rat benzo[a]pyrene increases methylation ISO PDLIM1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of PDLIM1 3' UTR CTD PMID:27901495 Pdlim1 Rat benzo[a]pyrene decreases expression ISO PDLIM1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PDLIM1 protein CTD PMID:32717239 Pdlim1 Rat benzo[a]pyrene increases expression ISO Pdlim1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PDLIM1 mRNA CTD PMID:22228805 Pdlim1 Rat bis(2-ethylhexyl) phthalate increases expression ISO PDLIM1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of PDLIM1 mRNA CTD PMID:31163220 Pdlim1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PDLIM1 mRNA CTD PMID:25181051 Pdlim1 Rat bisphenol A decreases methylation ISO PDLIM1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of PDLIM1 gene CTD PMID:31601247 Pdlim1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PDLIM1 mRNA CTD PMID:34947998 Pdlim1 Rat bisphenol A increases expression ISO PDLIM1 (Homo sapiens) 6480464 bisphenol A results in increased expression of PDLIM1 protein CTD PMID:37567409 Pdlim1 Rat bisphenol A decreases expression ISO PDLIM1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of PDLIM1 mRNA CTD PMID:29275510 Pdlim1 Rat bisphenol A multiple interactions ISO PDLIM1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of PDLIM1 gene and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PDLIM1 mRNA CTD PMID:28628672 and PMID:31601247 Pdlim1 Rat bisphenol AF increases expression ISO PDLIM1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of PDLIM1 protein CTD PMID:34186270 Pdlim1 Rat Bisphenol B increases expression ISO PDLIM1 (Homo sapiens) 6480464 bisphenol B results in increased expression of PDLIM1 protein CTD PMID:34186270 Pdlim1 Rat bisphenol F multiple interactions ISO PDLIM1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of PDLIM1 mRNA CTD PMID:28628672 Pdlim1 Rat bisphenol F increases expression ISO PDLIM1 (Homo sapiens) 6480464 bisphenol F results in increased expression of PDLIM1 protein CTD PMID:34186270 Pdlim1 Rat bisphenol F increases expression ISO Pdlim1 (Mus musculus) 6480464 bisphenol F results in increased expression of PDLIM1 mRNA CTD PMID:38685157 Pdlim1 Rat bleomycin A2 increases expression EXP 6480464 Bleomycin results in increased expression of PDLIM1 protein CTD PMID:25933445 Pdlim1 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of PDLIM1 mRNA CTD PMID:24136188 Pdlim1 Rat cadmium atom increases expression ISO PDLIM1 (Homo sapiens) 6480464 Cadmium results in increased expression of PDLIM1 mRNA CTD PMID:24376830 Pdlim1 Rat cadmium dichloride affects expression ISO PDLIM1 (Homo sapiens) 6480464 Cadmium Chloride affects the expression of PDLIM1 mRNA CTD PMID:25596134 Pdlim1 Rat caffeine decreases phosphorylation ISO PDLIM1 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of PDLIM1 protein CTD PMID:35688186 Pdlim1 Rat cantharidin decreases expression ISO Pdlim1 (Mus musculus) 6480464 Cantharidin results in decreased expression of PDLIM1 mRNA CTD PMID:36907384 Pdlim1 Rat chloroacetaldehyde decreases expression ISO PDLIM1 (Homo sapiens) 6480464 chloroacetaldehyde results in decreased expression of PDLIM1 mRNA CTD PMID:25596134 Pdlim1 Rat chlorpyrifos multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of PDLIM1 mRNA CTD PMID:33854195 Pdlim1 Rat cidofovir anhydrous increases expression ISO PDLIM1 (Homo sapiens) 6480464 Cidofovir results in increased expression of PDLIM1 mRNA CTD PMID:25596134 Pdlim1 Rat cisplatin affects expression ISO PDLIM1 (Homo sapiens) 6480464 Cisplatin affects the expression of PDLIM1 mRNA CTD PMID:23300844 Pdlim1 Rat cisplatin multiple interactions ISO PDLIM1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of PDLIM1 mRNA CTD PMID:27392435 Pdlim1 Rat cisplatin increases expression ISO PDLIM1 (Homo sapiens) 6480464 Cisplatin results in increased expression of PDLIM1 mRNA CTD PMID:25596134 and PMID:27392435 Pdlim1 Rat clodronic acid increases expression ISO PDLIM1 (Homo sapiens) 6480464 Clodronic Acid results in increased expression of PDLIM1 mRNA CTD PMID:25596134 Pdlim1 Rat cobalt dichloride decreases expression ISO PDLIM1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of PDLIM1 mRNA CTD PMID:19320972 Pdlim1 Rat corn oil affects expression EXP 6480464 Corn Oil affects the expression of PDLIM1 mRNA CTD PMID:16360708 Pdlim1 Rat coumarin increases phosphorylation ISO PDLIM1 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of PDLIM1 protein CTD PMID:35688186 Pdlim1 Rat coumestrol multiple interactions ISO PDLIM1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:19167446 Pdlim1 Rat coumestrol decreases expression ISO PDLIM1 (Homo sapiens) 6480464 Coumestrol results in decreased expression of PDLIM1 mRNA CTD PMID:19167446 Pdlim1 Rat cyclosporin A decreases expression ISO PDLIM1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PDLIM1 mRNA CTD PMID:20106945 and PMID:25596134 Pdlim1 Rat dexamethasone increases expression ISO PDLIM1 (Homo sapiens) 6480464 Dexamethasone results in increased expression of PDLIM1 mRNA CTD PMID:25047013 Pdlim1 Rat dexamethasone multiple interactions ISO PDLIM1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PDLIM1 mRNA more ... CTD PMID:28628672 Pdlim1 Rat dibutyl phthalate increases expression ISO Pdlim1 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of PDLIM1 mRNA CTD PMID:17361019 and PMID:21266533 Pdlim1 Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of PDLIM1 mRNA CTD PMID:18636392 Pdlim1 Rat dioxygen increases expression ISO PDLIM1 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of PDLIM1 mRNA CTD PMID:25596134 Pdlim1 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of PDLIM1 mRNA CTD PMID:21551480 Pdlim1 Rat dorsomorphin multiple interactions ISO PDLIM1 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Pdlim1 Rat doxorubicin decreases expression ISO PDLIM1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PDLIM1 mRNA CTD PMID:29803840 Pdlim1 Rat Enterolactone multiple interactions ISO PDLIM1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of PDLIM1 mRNA CTD PMID:19167446 Pdlim1 Rat entinostat increases expression ISO PDLIM1 (Homo sapiens) 6480464 entinostat results in increased expression of PDLIM1 mRNA CTD PMID:26272509 Pdlim1 Rat entinostat multiple interactions ISO PDLIM1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PDLIM1 mRNA CTD PMID:27188386 Pdlim1 Rat enzyme inhibitor multiple interactions ISO PDLIM1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of PDLIM1 protein CTD PMID:23301498 Pdlim1 Rat ethanol increases expression ISO Pdlim1 (Mus musculus) 6480464 Ethanol results in increased expression of PDLIM1 mRNA CTD PMID:30319688 Pdlim1 Rat ethyl methanesulfonate increases expression ISO PDLIM1 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of PDLIM1 mRNA CTD PMID:23649840 Pdlim1 Rat fenofibrate decreases expression EXP 6480464 Fenofibrate results in decreased expression of PDLIM1 mRNA CTD PMID:25596134 Pdlim1 Rat folpet increases expression ISO Pdlim1 (Mus musculus) 6480464 folpet results in increased expression of PDLIM1 mRNA CTD PMID:31558096 Pdlim1 Rat fulvestrant multiple interactions ISO PDLIM1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of PDLIM1 gene CTD PMID:31601247 Pdlim1 Rat fumonisin B1 increases expression ISO Pdlim1 (Mus musculus) 6480464 fumonisin B1 results in increased expression of PDLIM1 mRNA CTD PMID:16221962 Pdlim1 Rat furfural multiple interactions ISO PDLIM1 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Pdlim1 Rat gamma-hexachlorocyclohexane decreases expression EXP 6480464 Hexachlorocyclohexane results in decreased expression of PDLIM1 mRNA CTD PMID:17785943 Pdlim1 Rat gamma-linolenic acid decreases expression ISO PDLIM1 (Homo sapiens) 6480464 gamma-Linolenic Acid results in decreased expression of PDLIM1 mRNA CTD PMID:20664735 Pdlim1 Rat glyphosate multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of PDLIM1 mRNA CTD PMID:33854195 Pdlim1 Rat ibuprofen decreases expression ISO PDLIM1 (Homo sapiens) 6480464 Ibuprofen results in decreased expression of PDLIM1 mRNA CTD PMID:25596134 Pdlim1 Rat ibuprofen decreases expression EXP 6480464 Ibuprofen results in decreased expression of PDLIM1 mRNA CTD PMID:25596134 Pdlim1 Rat imidacloprid multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of PDLIM1 mRNA CTD PMID:33854195 Pdlim1 Rat indometacin multiple interactions ISO PDLIM1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PDLIM1 mRNA more ... CTD PMID:28628672 Pdlim1 Rat ivermectin decreases expression ISO PDLIM1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PDLIM1 protein CTD PMID:32959892 Pdlim1 Rat lead diacetate decreases expression ISO Pdlim1 (Mus musculus) 6480464 lead acetate results in decreased expression of PDLIM1 mRNA CTD PMID:22609695 Pdlim1 Rat lipopolysaccharide multiple interactions ISO PDLIM1 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Pdlim1 Rat mercury dibromide increases expression ISO PDLIM1 (Homo sapiens) 6480464 mercuric bromide results in increased expression of PDLIM1 mRNA CTD PMID:26272509 Pdlim1 Rat mercury dibromide multiple interactions ISO PDLIM1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PDLIM1 mRNA CTD PMID:27188386 Pdlim1 Rat metformin increases expression EXP 6480464 Metformin results in increased expression of PDLIM1 mRNA CTD PMID:25596134 Pdlim1 Rat methylmercury chloride decreases expression ISO PDLIM1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of PDLIM1 mRNA CTD PMID:23179753 Pdlim1 Rat methylmercury chloride multiple interactions ISO PDLIM1 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PDLIM1 mRNA CTD PMID:27188386 Pdlim1 Rat methylmercury chloride increases expression ISO PDLIM1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of PDLIM1 mRNA CTD PMID:26272509 Pdlim1 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of PDLIM1 mRNA CTD PMID:19638242 Pdlim1 Rat N-nitrosomorpholine affects expression EXP 6480464 N-nitrosomorpholine affects the expression of PDLIM1 protein CTD PMID:19716841 Pdlim1 Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of PDLIM1 mRNA CTD PMID:24136188 Pdlim1 Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of PDLIM1 mRNA CTD PMID:24136188 Pdlim1 Rat nitrates multiple interactions ISO Pdlim1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PDLIM1 mRNA CTD PMID:35964746 Pdlim1 Rat Nutlin-3 multiple interactions ISO PDLIM1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of PDLIM1 protein CTD PMID:38460933 Pdlim1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of PDLIM1 mRNA CTD PMID:25729387 Pdlim1 Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of PDLIM1 mRNA CTD PMID:18636392 Pdlim1 Rat panobinostat multiple interactions ISO PDLIM1 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PDLIM1 mRNA CTD PMID:27188386 Pdlim1 Rat panobinostat increases expression ISO PDLIM1 (Homo sapiens) 6480464 panobinostat results in increased expression of PDLIM1 mRNA CTD PMID:26272509 Pdlim1 Rat paracetamol affects expression ISO Pdlim1 (Mus musculus) 6480464 Acetaminophen affects the expression of PDLIM1 mRNA CTD PMID:17562736 Pdlim1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PDLIM1 mRNA CTD PMID:33387578 Pdlim1 Rat paracetamol increases expression ISO PDLIM1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of PDLIM1 mRNA CTD PMID:22230336 Pdlim1 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of PDLIM1 mRNA CTD PMID:32680482 Pdlim1 Rat paraquat increases expression ISO PDLIM1 (Homo sapiens) 6480464 Paraquat results in increased expression of PDLIM1 protein CTD PMID:34064677 Pdlim1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Pdlim1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PDLIM1 mRNA CTD PMID:36331819 Pdlim1 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of PDLIM1 mRNA CTD PMID:19162173 Pdlim1 Rat phenformin decreases expression EXP 6480464 Phenformin results in decreased expression of PDLIM1 mRNA CTD PMID:31324951 Pdlim1 Rat phenobarbital affects expression ISO Pdlim1 (Mus musculus) 6480464 Phenobarbital affects the expression of PDLIM1 mRNA CTD PMID:23091169 Pdlim1 Rat phenylmercury acetate increases expression ISO PDLIM1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of PDLIM1 mRNA CTD PMID:26272509 Pdlim1 Rat phenylmercury acetate multiple interactions ISO PDLIM1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PDLIM1 mRNA CTD PMID:27188386 Pdlim1 Rat pirinixic acid decreases expression ISO Pdlim1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of PDLIM1 mRNA CTD PMID:17426115 Pdlim1 Rat prednisolone increases expression ISO PDLIM1 (Homo sapiens) 6480464 Prednisolone results in increased expression of PDLIM1 mRNA CTD PMID:17379860 Pdlim1 Rat progesterone decreases expression ISO PDLIM1 (Homo sapiens) 6480464 Progesterone results in decreased expression of PDLIM1 mRNA CTD PMID:18070364 Pdlim1 Rat progesterone increases expression ISO PDLIM1 (Homo sapiens) 6480464 Progesterone results in increased expression of PDLIM1 mRNA CTD PMID:21795739 Pdlim1 Rat propiconazole increases expression ISO Pdlim1 (Mus musculus) 6480464 propiconazole results in increased expression of PDLIM1 mRNA CTD PMID:21278054 Pdlim1 Rat resveratrol multiple interactions ISO PDLIM1 (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in decreased expression of PDLIM1 mRNA CTD PMID:19167446 Pdlim1 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO PDLIM1 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Pdlim1 Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO PDLIM1 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of PDLIM1 mRNA CTD PMID:35811015 Pdlim1 Rat SB 431542 multiple interactions ISO PDLIM1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Pdlim1 Rat sodium arsenite increases expression ISO Pdlim1 (Mus musculus) 6480464 sodium arsenite results in increased expression of PDLIM1 protein CTD PMID:29044176 Pdlim1 Rat sodium chloride multiple interactions ISO PDLIM1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of PDLIM1 protein more ... CTD PMID:38598786 Pdlim1 Rat Soman increases expression EXP 6480464 Soman results in increased expression of PDLIM1 mRNA CTD PMID:19281266 Pdlim1 Rat sulforaphane decreases expression ISO PDLIM1 (Homo sapiens) 6480464 sulforaphane results in decreased expression of PDLIM1 mRNA CTD PMID:26833863 Pdlim1 Rat sunitinib decreases expression ISO PDLIM1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of PDLIM1 mRNA CTD PMID:31533062 Pdlim1 Rat T-2 toxin decreases expression EXP 6480464 T-2 Toxin results in decreased expression of PDLIM1 mRNA CTD PMID:26141394 Pdlim1 Rat tamoxifen affects expression ISO Pdlim1 (Mus musculus) 6480464 Tamoxifen affects the expression of PDLIM1 mRNA CTD PMID:17555576 Pdlim1 Rat tauroursodeoxycholic acid decreases expression EXP 6480464 ursodoxicoltaurine results in decreased expression of PDLIM1 mRNA CTD PMID:15885361 Pdlim1 Rat temozolomide decreases expression ISO PDLIM1 (Homo sapiens) 6480464 Temozolomide results in decreased expression of PDLIM1 mRNA CTD PMID:31758290 Pdlim1 Rat tetrachloromethane increases expression ISO Pdlim1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of PDLIM1 mRNA CTD PMID:27339419 and PMID:31919559 Pdlim1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of PDLIM1 mRNA CTD PMID:31150632 Pdlim1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of PDLIM1 mRNA] CTD PMID:31150632 Pdlim1 Rat thiabendazole multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of PDLIM1 mRNA CTD PMID:33854195 Pdlim1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PDLIM1 mRNA CTD PMID:23411599 Pdlim1 Rat titanium dioxide decreases methylation ISO Pdlim1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PDLIM1 gene and titanium dioxide results in decreased methylation of PDLIM1 promoter CTD PMID:35295148 Pdlim1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of PDLIM1 mRNA CTD PMID:25729387 Pdlim1 Rat trichostatin A increases expression ISO PDLIM1 (Homo sapiens) 6480464 trichostatin A results in increased expression of PDLIM1 mRNA CTD PMID:24935251 and PMID:26272509 Pdlim1 Rat trichostatin A multiple interactions ISO PDLIM1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PDLIM1 mRNA CTD PMID:27188386 Pdlim1 Rat triphenyl phosphate affects expression ISO PDLIM1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PDLIM1 mRNA CTD PMID:37042841 Pdlim1 Rat Triptolide decreases expression EXP 6480464 triptolide results in decreased expression of PDLIM1 protein CTD PMID:32519852 Pdlim1 Rat troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of PDLIM1 mRNA CTD PMID:25596134 Pdlim1 Rat trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of PDLIM1 mRNA CTD PMID:24136188 Pdlim1 Rat valproic acid affects expression ISO Pdlim1 (Mus musculus) 6480464 Valproic Acid affects the expression of PDLIM1 mRNA CTD PMID:17292431 Pdlim1 Rat valproic acid multiple interactions ISO PDLIM1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PDLIM1 mRNA CTD PMID:27188386 Pdlim1 Rat valproic acid increases expression ISO PDLIM1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PDLIM1 mRNA CTD PMID:23179753 more ... Pdlim1 Rat valproic acid affects expression ISO PDLIM1 (Homo sapiens) 6480464 Valproic Acid affects the expression of PDLIM1 mRNA CTD PMID:25979313 Pdlim1 Rat valproic acid decreases methylation ISO PDLIM1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of PDLIM1 gene CTD PMID:29154799 Pdlim1 Rat vancomycin decreases expression ISO Pdlim1 (Mus musculus) 6480464 Vancomycin results in decreased expression of PDLIM1 mRNA CTD PMID:18930951 Pdlim1 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of PDLIM1 mRNA CTD PMID:19015723 Pdlim1 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of PDLIM1 mRNA CTD PMID:23034163 Pdlim1 Rat zinc atom increases expression EXP 6480464 Zinc deficiency results in increased expression of PDLIM1 mRNA CTD PMID:11717422 Pdlim1 Rat zinc(0) increases expression EXP 6480464 Zinc deficiency results in increased expression of PDLIM1 mRNA CTD PMID:11717422
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,5-hexanedione (EXP) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) actinomycin D (ISO) adefovir pivoxil (ISO) aflatoxin B1 (EXP) all-trans-retinoic acid (EXP,ISO) ammonium chloride (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) atrazine (ISO) azoxystrobin (EXP) belinostat (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bleomycin A2 (EXP) buspirone (EXP) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) cantharidin (ISO) chloroacetaldehyde (ISO) chlorpyrifos (EXP) cidofovir anhydrous (ISO) cisplatin (ISO) clodronic acid (ISO) cobalt dichloride (ISO) corn oil (EXP) coumarin (ISO) coumestrol (ISO) cyclosporin A (ISO) dexamethasone (ISO) dibutyl phthalate (ISO) dichlorine (EXP) dioxygen (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) Enterolactone (ISO) entinostat (ISO) enzyme inhibitor (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) fenofibrate (EXP) folpet (ISO) fulvestrant (ISO) fumonisin B1 (ISO) furfural (ISO) gamma-hexachlorocyclohexane (EXP) gamma-linolenic acid (ISO) glyphosate (EXP) ibuprofen (EXP,ISO) imidacloprid (EXP) indometacin (ISO) ivermectin (ISO) lead diacetate (ISO) lipopolysaccharide (ISO) mercury dibromide (ISO) metformin (EXP) methylmercury chloride (ISO) N-nitrosodiethylamine (EXP) N-nitrosomorpholine (EXP) nefazodone (EXP) nimesulide (EXP) nitrates (ISO) Nutlin-3 (ISO) oxaliplatin (EXP) ozone (EXP) panobinostat (ISO) paracetamol (EXP,ISO) paraquat (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenformin (EXP) phenobarbital (ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) prednisolone (ISO) progesterone (ISO) propiconazole (ISO) resveratrol (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) sodium arsenite (ISO) sodium chloride (ISO) Soman (EXP) sulforaphane (ISO) sunitinib (ISO) T-2 toxin (EXP) tamoxifen (ISO) tauroursodeoxycholic acid (EXP) temozolomide (ISO) tetrachloromethane (EXP,ISO) thiabendazole (EXP) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) Triptolide (EXP) troglitazone (EXP) trovafloxacin (EXP) valproic acid (ISO) vancomycin (ISO) vinclozolin (EXP) zinc atom (EXP) zinc(0) (EXP)
Cellular Component
actin cytoskeleton (IDA) adherens junction (IBA) cytoplasm (IDA,IEA,ISO) cytoskeleton (IEA,ISO) filamentous actin (IBA) stress fiber (IBA,IDA,IEA,ISO) transcription regulator complex (IEA,ISO) Z disc (IBA,IDA,IEA,ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
4.
CLP36 and RIL recruit a-actinin-1 to stress fibers and differentially regulate stress fiber dynamics in F2408 fibroblasts.
Miyazaki K, etal., Exp Cell Res. 2012 Aug 15;318(14):1716-25. doi: 10.1016/j.yexcr.2012.05.006. Epub 2012 May 30.
5.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.
GOA pipeline
RGD automated data pipeline
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
9.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
10.
Cloning of a rat cDNA encoding a novel LIM domain protein with high homology to rat RIL.
Wang H, etal., Gene 1995 Nov 20;165(2):267-71.
Pdlim1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 248,991,818 - 249,040,409 (-) NCBI GRCr8 mRatBN7.2 1 239,042,372 - 239,091,074 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 239,042,385 - 239,091,076 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 247,178,448 - 247,226,759 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 253,882,359 - 253,930,342 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 246,535,402 - 246,583,385 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 259,308,326 - 259,357,006 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 259,308,296 - 259,357,056 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 266,752,410 - 266,800,840 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 245,350,086 - 245,399,534 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 245,446,644 - 245,496,093 (-) NCBI Celera 1 234,889,852 - 234,937,718 (-) NCBI Celera Cytogenetic Map 1 q54 NCBI
PDLIM1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 95,237,572 - 95,291,003 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 95,237,572 - 95,291,012 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 96,997,329 - 97,050,760 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 96,987,319 - 97,040,771 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 96,987,321 - 97,040,771 NCBI Celera 10 90,738,487 - 90,791,969 (-) NCBI Celera Cytogenetic Map 10 q23.33 NCBI HuRef 10 90,624,265 - 90,677,751 (-) NCBI HuRef CHM1_1 10 97,279,094 - 97,332,709 (-) NCBI CHM1_1 T2T-CHM13v2.0 10 96,116,721 - 96,170,181 (-) NCBI T2T-CHM13v2.0
Pdlim1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 40,210,683 - 40,260,060 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 40,209,617 - 40,260,286 (-) Ensembl GRCm39 Ensembl GRCm38 19 40,222,239 - 40,271,616 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 40,221,173 - 40,271,842 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 40,296,729 - 40,346,106 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 40,275,550 - 40,324,844 (-) NCBI MGSCv36 mm8 Celera 19 41,028,383 - 41,076,730 (-) NCBI Celera Cytogenetic Map 19 C3 NCBI cM Map 19 34.24 NCBI
Pdlim1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955507 1,495,925 - 1,523,925 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955507 1,499,223 - 1,525,924 (-) NCBI ChiLan1.0 ChiLan1.0
PDLIM1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 107,141,173 - 107,194,647 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 107,146,488 - 107,199,938 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 91,848,127 - 91,901,553 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 95,355,669 - 95,389,838 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 95,355,669 - 95,393,871 (-) Ensembl panpan1.1 panPan2
PDLIM1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 28 8,770,882 - 8,817,828 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 28 8,771,186 - 8,801,354 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 28 8,947,047 - 8,994,090 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 28 9,033,997 - 9,079,972 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 28 9,033,997 - 9,079,973 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 28 8,749,916 - 8,797,044 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 28 8,808,695 - 8,855,890 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 28 8,952,472 - 8,999,504 (-) NCBI UU_Cfam_GSD_1.0
Pdlim1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 38,044,314 - 38,087,612 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936636 4,083,071 - 4,126,739 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936636 4,083,413 - 4,126,728 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PDLIM1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 106,735,500 - 106,794,065 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 106,744,320 - 106,793,606 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 116,377,059 - 116,426,077 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PDLIM1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 88,398,814 - 88,452,660 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 88,397,294 - 88,452,610 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 49,270,732 - 49,324,931 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pdlim1
.
Predicted Target Of
Count of predictions: 298 Count of miRNA genes: 190 Interacting mature miRNAs: 213 Transcripts: ENSRNOT00000022000 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 631690 Scl5 Serum cholesterol level QTL 5 2.1 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 236125214 260522016 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 61327 Eae7 Experimental allergic encephalomyelitis QTL 7 5.6 body mass (VT:0001259) change in body weight (CMO:0002045) 1 216255568 260522016 Rat 1600392 Bw123 Body weight QTL 123 0.001 body mass (VT:0001259) body weight (CMO:0000012) 1 223201027 260522016 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 631837 Niddm35 Non-insulin dependent diabetes mellitus QTL 35 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 238699859 259647894 Rat 1600397 Edcs4 Endometrial carcinoma susceptibility QTL 4 2.2 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 1 206081677 251081677 Rat 631836 Stl31 Serum triglyceride level QTL 31 4.64 5e-06 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 237147813 260522016 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 1300108 Rf8 Renal function QTL 8 3.75 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 1 228581588 259647894 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 734767 Niddm57 Non-insulin dependent diabetes mellitus QTL 57 body mass (VT:0001259) body weight (CMO:0000012) 1 224054293 260122809 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631215 Stl8 Serum triglyceride level QTL 8 9.27 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 1 225126575 260522016 Rat 631843 Bw116 Body weight QTL 116 4.1 0.016 abdominal adipose amount (VT:1000220) abdominal fat pad weight (CMO:0000088) 1 224054293 260122809 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 731175 Uae20 Urinary albumin excretion QTL 20 3.5 0.0018 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 221264111 259647894 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 724538 Kidm1 Kidney mass QTL 1 3.2 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 213707201 252085212 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 734769 Niddm58 Non-insulin dependent diabetes mellitus QTL 58 body mass (VT:0001259) body weight (CMO:0000012) 1 224569538 260122809 Rat 734768 Niddm59 Non-insulin dependent diabetes mellitus QTL 59 body mass (VT:0001259) body weight (CMO:0000012) 1 213843987 258843987 Rat 1358890 Bp259 Blood pressure QTL 259 3.06 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 210702053 260522016 Rat 724533 Rf51 Renal function QTL 51 5.3 0.0002 kidney plasma flow trait (VT:0005524) renal plasma flow (CMO:0001914) 1 218753816 256448513 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 1549910 Bw54 Body weight QTL 54 0.05 body mass (VT:0001259) body weight (CMO:0000012) 1 214647894 259647894 Rat 70211 Niddm24 Non-insulin dependent diabetes mellitus QTL 24 3.79 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 214647894 259647894 Rat 1357399 Bw45 Body weight QTL 45 3.05 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 1 206329708 251329708 Rat 724552 Glom2 Glomerulus QTL 2 3.3 0.0001 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 1 222363780 260522016 Rat 2316896 Gluco57 Glucose level QTL 57 7.2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 228985440 245907899 Rat 1357404 Bw42 Body weight QTL 42 4.49 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 1 206329708 251329708 Rat 10053715 Scort24 Serum corticosterone level QTL 24 2.13 0.0088 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 221414816 260522016 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 1358916 Kidm22 Kidney mass QTL 22 3.32 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 210702053 240947965 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 61400 Niddm1 Non-insulin dependent diabetes mellitus QTL 1 11 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 218753689 245907899 Rat 10059587 Bw173 Body weight QTL 173 3.23 0.025 body mass (VT:0001259) body weight (CMO:0000012) 1 202069611 247069611 Rat 2292216 Bw80 Body weight QTL 80 3.23 0.0019 body mass (VT:0001259) body weight (CMO:0000012) 1 213533809 243914901 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 2293700 Bmd27 Bone mineral density QTL 27 6.6 0.0001 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 224054293 243747962 Rat 2293701 Bmd34 Bone mineral density QTL 34 8.3 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 1 224054293 243747962 Rat 7387289 Uae45 Urinary albumin excretion QTL 45 2.86 0.0021 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 223262787 260522016 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 1581544 Rf52 Renal function QTL 52 0.05 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 1 232156370 259647894 Rat 1600363 Hc6 Hypercalciuria QTL 6 2.7 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 203995416 244113296 Rat 631536 Lnnr2 Liver neoplastic nodule remodeling QTL 2 2.9 0.0005 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 1 233948574 260522016 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 2302040 Pia35 Pristane induced arthritis QTL 35 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 216255568 260522016 Rat 631669 Iddm9 Insulin dependent diabetes mellitus QTL 9 2.8 0.039 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 233190394 258625266 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat 1598821 Rf55 Renal function QTL 55 6.3 renal blood flow trait (VT:2000006) ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239) 1 218748008 257976495 Rat
AI029470
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 239,042,435 - 239,042,653 (+) MAPPER mRatBN7.2 Rnor_6.0 1 259,308,388 - 259,308,605 NCBI Rnor6.0 Rnor_5.0 1 266,752,472 - 266,752,689 UniSTS Rnor5.0 RGSC_v3.4 1 245,350,148 - 245,350,365 UniSTS RGSC3.4 Celera 1 234,889,914 - 234,890,131 UniSTS RH 3.4 Map 1 1619.02 UniSTS Cytogenetic Map 1 q53 UniSTS
BE108553
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 239,085,522 - 239,085,690 (+) MAPPER mRatBN7.2 Rnor_6.0 1 259,351,561 - 259,351,728 NCBI Rnor6.0 Rnor_5.0 1 266,795,395 - 266,795,562 UniSTS Rnor5.0 RGSC_v3.4 1 245,394,089 - 245,394,256 UniSTS RGSC3.4 Celera 1 234,932,277 - 234,932,444 UniSTS RH 3.4 Map 1 1618.9 UniSTS Cytogenetic Map 1 q53 UniSTS
AU047677
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 239,086,072 - 239,086,202 (+) MAPPER mRatBN7.2 Rnor_6.0 1 259,352,111 - 259,352,240 NCBI Rnor6.0 Rnor_5.0 1 266,795,945 - 266,796,074 UniSTS Rnor5.0 RGSC_v3.4 1 245,394,639 - 245,394,768 UniSTS RGSC3.4 Celera 1 234,932,827 - 234,932,956 UniSTS Cytogenetic Map 1 q53 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000022000 ⟹ ENSRNOP00000022000
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 239,042,385 - 239,091,076 (-) Ensembl Rnor_6.0 Ensembl 1 259,308,296 - 259,357,056 (-) Ensembl
RefSeq Acc Id:
NM_017365 ⟹ NP_059061
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 248,991,818 - 249,040,409 (-) NCBI mRatBN7.2 1 239,042,374 - 239,090,968 (-) NCBI Rnor_6.0 1 259,308,326 - 259,357,006 (-) NCBI Rnor_5.0 1 266,752,410 - 266,800,840 (-) NCBI RGSC_v3.4 1 245,350,086 - 245,399,534 (-) RGD Celera 1 234,889,852 - 234,937,718 (-) RGD
Sequence:
CCGGGATCCCTGCGCGCCGTGGTGTTCTGTGCCTTGCCGGTCTGTTCCCTCCGATTGTGCCTAGCAATGACCACCCAGCAGATTGTTCTCCAGGGCCCGGGACCCTGGGGTTTCCGACTCGTGGGCGG
hide sequence
RefSeq Acc Id:
NP_059061 ⟸ NM_017365
- UniProtKB:
Q6IN45 (UniProtKB/Swiss-Prot), P52944 (UniProtKB/Swiss-Prot), A6JH56 (UniProtKB/TrEMBL)
- Sequence:
MTTQQIVLQGPGPWGFRLVGGKDFEQPLAISRVTPGSKAAIANLCIGDLITAIDGEDTSSMTHLEAQNKIKGCVDNMTLTVSRSEQKIWSPLVTEEGKRHPYKMNLASEPQEVLHIGSAHNRSAMPFT
hide sequence
Ensembl Acc Id:
ENSRNOP00000022000 ⟸ ENSRNOT00000022000
RGD ID: 13690896 Promoter ID: EPDNEW_R1421 Type: initiation region Name: Pdlim1_1 Description: PDZ and LIM domain 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 259,357,013 - 259,357,073 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2009-02-26
Pdlim1
PDZ and LIM domain 1
Pdlim1
PDZ and LIM domain 1 (elfin)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Pdlim1
PDZ and LIM domain 1 (elfin)
PDZ and LIM domain 1
Name updated
1299863 APPROVED
2002-06-10
Pdlim1
PDZ and LIM domain 1
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_expression
decreased mRNA expression occurs in response to chemical hypoxia
68225
