Advanced Search (OLGA)

Gene: Avpr1b (arginine vasopressin receptor 1B) Rattus norvegicus

Analyze

Symbol:

Avpr1b

Name:

arginine vasopressin receptor 1B

RGD ID:

6502812

Description:

Enables identical protein binding activity; peptide hormone binding activity; and vasopressin receptor activity. Involved in several processes, including adenylate cyclase-modulating G protein-coupled receptor signaling pathway; positive regulation of cellular pH reduction; and positive regulation of glutamate secretion. Located in dendrite. Used to study anxiety disorder and depressive disorder. Biomarker of alcohol dependence. Human ortholog(s) of this gene implicated in autism spectrum disorder; bipolar disorder; and mood disorder. Orthologous to human AVPR1B (arginine vasopressin receptor 1B); PARTICIPATES IN G protein mediated signaling pathway via Galphaq family; G protein mediated signaling pathway via Galphas family; vasopressin signaling pathway; INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 6-propyl-2-thiouracil; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

antidiuretic hormone receptor 1b; AVPR V1b; AVPR V3; LOC100909648; V1bR; vasopressin V1b receptor; vasopressin V1b receptor-like; vasopressin V3 receptor

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	AVPR1B (arginine vasopressin receptor 1B)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Avpr1b (arginine vasopressin receptor 1B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Avpr1b (arginine vasopressin receptor 1B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	AVPR1B (arginine vasopressin receptor 1B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	AVPR1B (arginine vasopressin receptor 1B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Avpr1b (arginine vasopressin receptor 1B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	AVPR1B (vasopressin receptor 1B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	AVPR1B (arginine vasopressin receptor 1B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Avpr1b (arginine vasopressin receptor 1B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Avpr1b (arginine vasopressin receptor 1B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Chinchilla lanigera (long-tailed chinchilla):	Avpr1b (arginine vasopressin receptor 1B)	ENTREZGENE	gene_group.gz
Alliance orthologs ³
Mus musculus (house mouse):	Avpr1b (arginine vasopressin receptor 1B)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	AVPR1B (arginine vasopressin receptor 1B)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ntr-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ntr-2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	avpr1b	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	avpr1b	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	45,598,116 - 45,611,680 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	45,598,763 - 45,611,277 (+)	Ensembl				GRCr8
mRatBN7.2	13	43,046,531 - 43,059,046 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	43,046,267 - 43,057,792 (+)	Ensembl				mRatBN7.2
Dahl_SR_JrHsd	13	44,973,425 - 44,985,872 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	13	45,205,886 - 45,218,387 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	13	45,171,164 - 45,183,611 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	13	45,125,276 - 45,137,777 (+)	NCBI		F344_StmMcwi
Rnor_6.0	13	48,390,434 - 48,400,583 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	48,390,417 - 48,400,632 (-)	Ensembl			rn6	Rnor6.0
Rnor_6.0 Ensembl	13	48,367,307 - 48,378,831 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	53,465,718 - 53,475,867 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Cytogenetic Map	13	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

ACTH-secreting pituitary adenoma (ISO)

alcohol dependence (IEP)

anxiety disorder (IMP,ISO)

autism spectrum disorder (ISO)

bipolar disorder (ISO)

Cushing Syndrome (ISO)

depressive disorder (IMP,ISO)

mood disorder (ISO)

pituitary adenoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acetamides (ISO)

ammonium chloride (EXP)

Azoxymethane (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP)

chlorpyrifos (ISO)

copper atom (EXP)

copper(0) (EXP)

decabromodiphenyl ether (EXP)

dextran sulfate (ISO)

dieldrin (EXP)

fipronil (EXP)

genistein (EXP)

linsidomine (EXP)

methoxychlor (EXP)

Nonylphenol (EXP)

ozone (ISO)

paracetamol (ISO)

paraquat (EXP)

potassium dichromate (ISO)

quinazolines (ISO)

sodium arsenite (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-modulating G protein-coupled receptor signaling pathway (IDA)

cellular response to hormone stimulus (IBA)

G protein-coupled receptor signaling pathway (IBA,IDA,IEA,ISO)

phospholipase C-activating G protein-coupled receptor signaling pathway (IEA,ISO)

positive regulation of arachidonate secretion (IEA,ISO)

positive regulation of cellular pH reduction (IEA,IMP)

positive regulation of cytosolic calcium ion concentration (IMP)

positive regulation of glutamate secretion (IEA,IMP)

positive regulation of inositol phosphate biosynthetic process (IEA,ISO)

positive regulation of MAPK cascade (IEA,ISO)

positive regulation of vasoconstriction (IBA)

regulation of blood pressure (IEA,ISO)

regulation of cell population proliferation (IEA,ISO)

regulation of systemic arterial blood pressure by vasopressin (IBA,ISO)

signal transduction (IEA)

symbiont entry into host cell (IEA)

Cellular Component

dendrite (IDA)

Golgi apparatus (IEA,ISO)

membrane (IEA)

plasma membrane (IBA,IEA,ISO)

Molecular Function

G protein-coupled receptor activity (IEA)

identical protein binding (IPI)

peptide hormone binding (IDA,IMP)

vasopressin receptor activity (IBA,IDA,IEA,IMP,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

calcium/calcium-mediated signaling pathway (IEA)

G protein mediated signaling pathway via Galphaq family (IDA,ISO)

G protein mediated signaling pathway via Galphas family (IDA)

vasopressin signaling pathway (IDA,ISO,TAS)

vasopressin signaling pathway via receptor type 1 (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Effect of vasopressin V1b receptor antagonist, SSR149415, on anxiety-like behavior and Lewis lung carcinoma metastasis in mice.	Amikishieva AV, etal., Exp Oncol. 2011 Sep;33(3):126-9.
2.	Evidence that vasopressin V1b receptors mediate the transition to excessive drinking in ethanol-dependent rats.	Edwards S, etal., Addict Biol. 2012 Jan;17(1):76-85. doi: 10.1111/j.1369-1600.2010.00291.x. Epub 2011 Feb 11.
3.	ASD and Genetic Associations with Receptors for Oxytocin and Vasopressin-AVPR1A, AVPR1B, and OXTR.	Francis SM, etal., Front Neurosci. 2016 Nov 22;10:516. doi: 10.3389/fnins.2016.00516. eCollection 2016.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
6.	Vasopressin V1a, V1b and V2 receptors mRNA in the kidney and heart of the renin transgenic TGR(mRen2)27 and Sprague Dawley rats.	Gozdz A, etal., J Physiol Pharmacol 2002 Sep;53(3):349-57.
7.	Immunohistochemical localization of the vasopressin V1b receptor in the rat brain and pituitary gland: anatomical support for its involvement in the central effects of vasopressin.	Hernando F, etal., Endocrinology 2001 Apr;142(4):1659-68.
8.	Science review: Vasopressin and the cardiovascular system part 1--receptor physiology.	Holmes CL, etal., Crit Care. 2003 Dec;7(6):427-34. Epub 2003 Jun 26.
9.	The vasopressin receptors colocalize with vasopressin in the magnocellular neurons of the rat supraoptic nucleus and are modulated by water balance.	Hurbin A, etal., Endocrinology 2002 Feb;143(2):456-66.
10.	Antidepressant and anxiolytic profiles of newly synthesized arginine vasopressin V1B receptor antagonists: TASP0233278 and TASP0390325.	Iijima M, etal., Br J Pharmacol. 2014 Jul;171(14):3511-25. doi: 10.1111/bph.12699.
11.	Association between OPCRIT dimensions and polymorphisms of HPA axis genes in bipolar disorder.	Leszczyńska-Rodziewicz A, etal., J Affect Disord. 2013 Nov;151(2):744-7. doi: 10.1016/j.jad.2013.08.012. Epub 2013 Aug 23.
12.	No association between polymorphisms and haplotypes of the AVPR1b, CRHR1 and NR3C1 genes and depression with melancholic features in the course of bipolar disorder.	Leszczyńska-Rodziewicz A, etal., Psychiatry Res. 2013 May 15;207(1-2):140-2. doi: 10.1016/j.psychres.2012.09.025. Epub 2012 Oct 12.
13.	Extrapituitary expression of the rat V1b vasopressin receptor gene.	Lolait SJ, etal., Proc Natl Acad Sci U S A 1995 Jul 18;92(15):6783-7.
14.	A cellular and molecular basis for the selective desmopressin-induced ACTH release in Cushing disease patients: key role of AVPR1b receptor and potential therapeutic implications.	Luque RM, etal., J Clin Endocrinol Metab. 2013 Oct;98(10):4160-9. doi: 10.1210/jc.2013-1992. Epub 2013 Jul 24.
15.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
16.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
17.	Differential coupling of the vasopressin V1b receptor through compartmentalization within the plasma membrane.	Orcel H, etal., Mol Pharmacol. 2009 Mar;75(3):637-47. Epub 2008 Dec 1.
18.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
19.	Reduced vasopressin receptors activation mediates the anti-depressant effects of fluoxetine and venlafaxine in bulbectomy model of depression.	Poretti MB, etal., Psychopharmacology (Berl). 2016 Mar;233(6):1077-86. doi: 10.1007/s00213-015-4187-4. Epub 2015 Dec 23.
20.	GOA pipeline	RGD automated data pipeline
21.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
22.	Arginine-vasopressin modulates intracellular pH via V1 and V2 receptors in renal collecting duct cells.	Rivarola V, etal., Cell Physiol Biochem. 2007;20(5):549-58.
23.	Contribution of molecular analysis to the typification of the non-functioning pituitary adenomas.	Sanchez-Tejada L, etal., PLoS One. 2017 Jul 10;12(7):e0180039. doi: 10.1371/journal.pone.0180039. eCollection 2017.
24.	Arginine vasopressin increases glutamate release and intracellular Ca2+ concentration in hippocampal and cortical astrocytes through two distinct receptors.	Syed N, etal., J Neurochem. 2007 Oct;103(1):229-37.
25.	Epistatic interaction between CRHR1 and AVPR1b variants as a predictor of major depressive disorder.	Szczepankiewicz A, etal., Psychiatr Genet. 2013 Dec;23(6):239-46. doi: 10.1097/YPG.0000000000000007.
26.	Effects of vasopressin on isolated rat adrenal chromaffin cells.	Takeda M, etal., Regul Pept 2002 Jun 15;106(1-3):55-65.
27.	Transcriptional regulation of the pituitary vasopressin V1b receptor involves a GAGA-binding protein.	Volpi S, etal., J Biol Chem 2002 Aug 2;277(31):27829-38.
28.	Vasopressin V1b receptor knockout reduces aggressive behavior in male mice.	Wersinger SR, etal., Mol Psychiatry 2002;7(9):975-84.
29.	Salt-loading increases vasopressin and vasopressin 1b receptor mRNA in the hypothalamus and choroid plexus.	Zemo DA and McCabe JT, Neuropeptides 2001 Jun-Aug;35(3-4):181-8.

Additional References at PubMed

PMID:7626108	PMID:9322919	PMID:10792583	PMID:11287361	PMID:12486173	PMID:12869588	PMID:15528211	PMID:15632090	PMID:17355321	PMID:18508119	PMID:19033533	PMID:21858088
PMID:22178035	PMID:23488898	PMID:23580725	PMID:25283607	PMID:25560210	PMID:25605313	PMID:26651338	PMID:27998960	PMID:32415179	PMID:33264070

Genomics

Comparative Map Data

Avpr1b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	45,598,116 - 45,611,680 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	45,598,763 - 45,611,277 (+)	Ensembl				GRCr8
mRatBN7.2	13	43,046,531 - 43,059,046 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	43,046,267 - 43,057,792 (+)	Ensembl				mRatBN7.2
Dahl_SR_JrHsd	13	44,973,425 - 44,985,872 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	13	45,205,886 - 45,218,387 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	13	45,171,164 - 45,183,611 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	13	45,125,276 - 45,137,777 (+)	NCBI		F344_StmMcwi
Rnor_6.0	13	48,390,434 - 48,400,583 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	48,390,417 - 48,400,632 (-)	Ensembl			rn6	Rnor6.0
Rnor_6.0 Ensembl	13	48,367,307 - 48,378,831 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	53,465,718 - 53,475,867 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Cytogenetic Map	13	q13	NCBI

AVPR1B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	206,106,936 - 206,117,388 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	206,106,936 - 206,117,699 (-)	Ensembl			hg38	GRCh38
GRCh37	1	206,223,943 - 206,234,395 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	204,390,567 - 204,398,262 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	202,767,010 - 202,774,698	NCBI
Celera	1	179,215,868 - 179,223,067 (-)	NCBI		Celera
Cytogenetic Map	1	q32.1	NCBI
HuRef	1	177,157,341 - 177,164,470 (+)	NCBI		HuRef
CHM1_1	1	207,555,388 - 207,562,587 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	205,370,978 - 205,381,434 (-)	NCBI		T2T-CHM13v2.0

Avpr1b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	131,526,908 - 131,539,740 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	131,526,977 - 131,539,738 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	131,599,114 - 131,612,000 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	131,599,239 - 131,612,000 (+)	Ensembl			mm10	GRCm38
MGSCv37	1	133,495,691 - 133,508,577 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	133,426,660 - 133,439,546 (+)	NCBI		MGSCv36	mm8
Celera	1	134,211,156 - 134,224,033 (+)	NCBI		Celera
Cytogenetic Map	1	E4	NCBI
cM Map	1	57.09	NCBI

Avpr1b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955406	41,705,305 - 41,716,173 (-)	Ensembl
ChiLan1.0	NW_004955406	41,706,088 - 41,716,173 (-)	NCBI	ChiLan1.0	ChiLan1.0

AVPR1B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	43,254,921 - 43,264,892 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	43,220,427 - 43,230,407 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	181,713,548 - 181,723,645 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	185,996,869 - 186,007,043 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	185,999,627 - 186,007,043 (-)	Ensembl			panPan2	panpan1.1

AVPR1B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	38	2,440,574 - 2,446,037 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	38	2,440,615 - 2,446,037 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	38	2,527,072 - 2,539,143 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	38	2,432,354 - 2,444,078 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	38	2,438,108 - 2,443,530 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	38	2,426,053 - 2,437,770 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	38	2,818,206 - 2,830,306 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	38	3,018,527 - 3,030,626 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Avpr1b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	69,175,333 - 69,183,581 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936557	6,415,547 - 6,424,711 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936557	6,415,544 - 6,423,863 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

AVPR1B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	66,772,591 - 66,776,931 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	9	66,769,472 - 66,776,916 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	73,019,057 - 73,024,469 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

AVPR1B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	23,234,651 - 23,244,403 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	25	23,234,823 - 23,241,159 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666055	23,931,432 - 23,942,062 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Avpr1b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624807	5,237,036 - 5,241,845 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624807	5,237,036 - 5,247,383 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Avpr1b
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	10	4,214,511 - 4,226,088 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Avpr1b
160 total Variants

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10755495	Bp387	Blood pressure QTL 387	3.78		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	37216241	90057603	Rat
9589141	Insul28	Insulin level QTL 28	10.82	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	13	11866254	56866254	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	38975045	103588154	Rat
70220	Bp55	Blood pressure QTL 55	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	39924693	84924693	Rat
61391	Bp5	Blood pressure QTL 5	5.6		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	24853925	69853925	Rat
4889861	Pur29	Proteinuria QTL 29	13.8	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	39968211	83286298	Rat
1300163	Cardf1	Cardiac cell morphology QTL 1	4.18		aorta morphology trait (VT:0000272)	artery lesion measurement (CMO:0000975)	13	12448421	47969993	Rat
2317040	Aia21	Adjuvant induced arthritis QTL 21	2.75		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	13	12384320	57384320	Rat
631645	Bp121	Blood pressure QTL 121	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	17468282	62468282	Rat
2317046	Aia8	Adjuvant induced arthritis QTL 8	3.9700000286102295		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	13	12384320	57384320	Rat
619615	Bp80	Blood pressure QTL 80		0.0354	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	7421791	87286911	Rat
2303032	Bp328	Blood pressure QTL 328			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	43736327	47969993	Rat
61339	Bp24	Blood pressure QTL 24		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	6002008	47359539	Rat
1331784	Bp222	Blood pressure QTL 222	2.944		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	24335432	55601132	Rat
61340	Bp25	Blood pressure QTL 25	4.2	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	37087983	82087983	Rat
1581573	Uae36	Urinary albumin excretion QTL 36			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
1549897	Stresp12	Stress response QTL 12	3.35		stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	13	40983585	85983585	Rat
2302275	Gluco37	Glucose level QTL 37	3.8		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	13	12448421	48744906	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	21120177	109350286	Rat
1558644	Cm45	Cardiac mass QTL 45	3.6	0.002	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	13	26244808	71244808	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	13	33794096	78794096	Rat
61349	Bp31	Blood pressure QTL 31	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	39924693	84924693	Rat
2303563	Bw89	Body weight QTL 89	6		body mass (VT:0001259)	body weight (CMO:0000012)	13	34834947	79834947	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	11081740	103588154	Rat
2301962	Cm72	Cardiac mass QTL 72	4.12		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	13	33794096	60914504	Rat
1581554	Pur11	Proteinuria QTL 11			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
12879471	Bp398	Blood pressure QTL 398			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	3088755	48088755	Rat
12879477	Bp401	Blood pressure QTL 401			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	39814726	84814726	Rat
1331750	Bp220	Blood pressure QTL 220	2.98		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	39968211	84968211	Rat
6893338	Cm76	Cardiac mass QTL 76	0	0.99	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	13	26244808	71244808	Rat
11530006	Niddm72	Non-insulin dependent diabetes mellitus QTL 72		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	38286298	83286298	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	103588154	Rat
9589164	Gluco66	Glucose level QTL 66	6.67	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	13	17711336	62711336	Rat
7411662	Foco29	Food consumption QTL 29	20.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	13	11866254	56866254	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
17	19	67	46	38	14	14	14	12	102	66	9	36	5	28	24	5	5

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001289800	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271945	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB042197	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF064541	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF314527	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473958	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D45400	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U27322	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000074204 ⟹ ENSRNOP00000067252

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	13	48,390,417 - 48,400,632 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000074512 ⟹ ENSRNOP00000064689

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	45,598,763 - 45,611,277 (+)	Ensembl
mRatBN7.2 Ensembl	13	43,046,267 - 43,057,792 (+)	Ensembl
Rnor_6.0 Ensembl	13	48,367,307 - 48,378,831 (+)	Ensembl

RefSeq Acc Id:

NM_001289800 ⟹ NP_001276729

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	45,598,763 - 45,611,277 (+)	NCBI
mRatBN7.2	13	43,046,531 - 43,059,046 (+)	NCBI
Dahl_SR_JrHsd	13	44,973,425 - 44,985,872 (+)	NCBI
Lyon_Normotensive	13	45,205,886 - 45,218,387 (+)	NCBI
Lyon_Hypertensive	13	45,171,164 - 45,183,611 (+)	NCBI
F344_StmMcwi	13	45,125,276 - 45,137,777 (+)	NCBI
Rnor_6.0	13	48,390,434 - 48,400,583 (-)	NCBI

Sequence:

show sequence

CTCCCTTCTCTCCACCTCTAAACCTTTCTCTCTCATTCCATTTTATCTATCAAAGTTCTTACTT
GCACCCATACCTCCATCCACCTTCCCCTCCTTCTCTCCCTGAAATTCTAACTATGAATTCTGAG
CCTTCTTGGACTGCCACCCCCTCCCCTGGGGGCACCCTGCCTGTCCCCAATGCTACCACACCGT
GGCTAGGTAGGGATGAAGAGCTAGCCAAGGTGGAGATCGGTATCCTAGCTACTGTCCTGGTTCT
GGCCACAGGAGGCAACCTGGCTGTACTTCTGACTCTGGGCCGCCATGGCCACAAGCGCTCCCGC
ATGCATCTGTTCGTGCTGCACTTGGCCCTGACCGACCTGGGCGTGGCGCTTTTCCAGGTACTGC
CTCAGCTGCTCTGGGACATCACCTACCGCTTCCAGGGCTCTGACCTCCTCTGCCGGGCTGTCAA
GTATCTACAGGTGCTCAGCATGTTTGCTTCCACTTACATGCTGCTGGCCATGACACTGGACCGG
TACCTGGCTGTCTGTCACCCTCTTCGAAGCCTCCGGCAGCCCAGCCAGTCTACCTACCCTCTCA
TTGCTGCTCCCTGGTTGCTGGCTGCCATCCTCAGCCTCCCTCAAGTTTTCATTTTTTCATTGCG
AGAGGTGATCCAGGGCTCAGGGGTGCTGGACTGCTGGGCAGATTTCTACTTTTCCTGGGGCCCG
CGGGCCTACATCACCTGGACCACCATGGCTATCTTTGTGCTGCCGGTGGCGGTGCTCACAGCTT
GCTACGGCCTCATCTGCCACGAGATCTACAAGAACCTGAAAGTCAAGACCCAGGCTGGCAGGGA
GGAGAGGAGGGGCTGGCGGACTTGGGATAAGTCCTCATCTTCTGCAGCCACGAGGGGGCTACCT
TCCCGGGTCAGCAGCATCAGTACCATCTCCAGGGCAAAGATCCGAACCGTGAAGATGACCTTTG
TCATCGTGCTGGCCTACATTGCTTGCTGGGCACCTTTCTTCAGTGTCCAGATGTGGTCTGTGTG
GGATGAGAATGCCCCCAATGAAGATTCTACCAATGTGGCTTTCACCATCTCCATGCTTCTGGGC
AACCTCAGCAGCTGCTGCAACCCCTGGATCTACATGGGCTTCAACAGTCGCCTGTTGCCACGTT
CCTTGAGCCACCATGCCTGCTGCACGGGCTCTAAGCCCCAAGTGCACAGGCAACTCTCCACCAG
CAGCCTCACTAGCCGTCGCACTACGCTGCTGACCCATGCCTGTGGTTCCCCTACTCTCCGACTC
AGCCTTAACCTCAGCCTCCGTGCAAAGCCCAGACCTGCAGGCTCACTGAAGGATTTAGAGCAGG
TGGACGGGGAAGCCACTATGGAGACCAGCATCTTTTAGAGAAGATTCCCTGGACTCTGGTTCTG
CACATCTCAGGCACCCGGAATGTGGACTAGCCGGCTCAGGGA

hide sequence

RefSeq Acc Id:

XM_063271945 ⟹ XP_063128015

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	45,598,116 - 45,611,680 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001276729	(Get FASTA)	NCBI Sequence Viewer
	XP_063128015	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC16882	(Get FASTA)	NCBI Sequence Viewer
	AAC52235	(Get FASTA)	NCBI Sequence Viewer
	AAG33861	(Get FASTA)	NCBI Sequence Viewer
	BAA08242	(Get FASTA)	NCBI Sequence Viewer
	BAA94998	(Get FASTA)	NCBI Sequence Viewer
	EDM09824	(Get FASTA)	NCBI Sequence Viewer
	EDM09825	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000064689
GenBank Protein	P48974	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001276729 ⟸ NM_001289800

- UniProtKB:

P48974 (UniProtKB/Swiss-Prot), G3V6U8 (UniProtKB/TrEMBL), A6IC22 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MNSEPSWTATPSPGGTLPVPNATTPWLGRDEELAKVEIGILATVLVLATGGNLAVLLTLGRHGH
KRSRMHLFVLHLALTDLGVALFQVLPQLLWDITYRFQGSDLLCRAVKYLQVLSMFASTYMLLAM
TLDRYLAVCHPLRSLRQPSQSTYPLIAAPWLLAAILSLPQVFIFSLREVIQGSGVLDCWADFYF
SWGPRAYITWTTMAIFVLPVAVLTACYGLICHEIYKNLKVKTQAGREERRGWRTWDKSSSSAAT
RGLPSRVSSISTISRAKIRTVKMTFVIVLAYIACWAPFFSVQMWSVWDENAPNEDSTNVAFTIS
MLLGNLSSCCNPWIYMGFNSRLLPRSLSHHACCTGSKPQVHRQLSTSSLTSRRTTLLTHACGSP
TLRLSLNLSLRAKPRPAGSLKDLEQVDGEATMETSIF

hide sequence

Ensembl Acc Id:

ENSRNOP00000067252 ⟸ ENSRNOT00000074204

Ensembl Acc Id:

ENSRNOP00000064689 ⟸ ENSRNOT00000074512

RefSeq Acc Id:	XP_063128015 ⟸ XM_063271945
- Peptide Label:	isoform X1
- UniProtKB:	P48974 (UniProtKB/Swiss-Prot), A6IC22 (UniProtKB/TrEMBL), G3V6U8 (UniProtKB/TrEMBL)

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P48974-F1-model_v2	AlphaFold	P48974	1-425	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:6502812	AgrOrtholog
BioCyc Gene	G2FUF-18344	BioCyc
Ensembl Genes	ENSRNOG00000048522	Ensembl, ENTREZGENE
	ENSRNOG00000049261	Ensembl
Ensembl Transcript	ENSRNOT00000074512	ENTREZGENE
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
InterPro	DUF1856	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
	Vasoprsn_rcpt	UniProtKB/Swiss-Prot
	Vprs_rcpt_V1B	UniProtKB/Swiss-Prot
NCBI Gene	LOC100909648	ENTREZGENE
PANTHER	NEUROPEPTIDE RECEPTOR-RELATED G-PROTEIN COUPLED RECEPTOR	UniProtKB/Swiss-Prot
	VASOPRESSIN V1B RECEPTOR	UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot
	DUF1856	UniProtKB/Swiss-Prot
PhenoGen	Avpr1b	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot
	VASOPRESSINR	UniProtKB/Swiss-Prot
	VASOPRSNV1BR	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000048522	RatGTEx
	ENSRNOG00000049261	RatGTEx
SMART	DUF1856	UniProtKB/Swiss-Prot
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
UniProt	A6IC22	ENTREZGENE, UniProtKB/TrEMBL
	A6IC23_RAT	UniProtKB/TrEMBL
	G3V6U8	ENTREZGENE, UniProtKB/TrEMBL
	P48974	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-07-01	Avpr1b	arginine vasopressin receptor 1B	LOC100909648	vasopressin V1b receptor-like	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2021-07-01	LOC100909648	vasopressin V1b receptor-like	Avpr1b	arginine vasopressin receptor 1B	Data merged from RGD:61886	737654	PROVISIONAL
2012-07-05	LOC100909648	vasopressin V1b receptor-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2004-09-10	Avpr1b	arginine vasopressin receptor 1B		arginine vasopressin receptor 1B	Name updated	1299863	APPROVED
2002-06-10	Avpr1b	arginine vasopressin receptor 1B			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	localizes to plasma membrane	628482
gene_expression	expressed in supraoptic nucleus	70387
gene_expression	expressed in hypothalamus, amygdala, crebellum; after colchicine treatment expressed in hippocampus,cortex,olfactory bulb and cerebellum	628482
gene_process	functions in water balance	61542
gene_process	functions in water balance	70387
gene_process	may be involved in vasopressin effects on thermoregulation and stimulation of CRH secretion from hypothalamus	628482
gene_product	127kDa protein	625573
gene_protein	127kDa in size	625573
gene_regulation	GAGA binding proteins bind to the GAGA box (present at the proximal end) to activate the gene	625573
gene_regulation	GAGA binding proteins bind to the GAGA box ( present at the proximal end) to activate the gene	628482
gene_transcript	contains several GAGA repeats upstream of the main GAGA box that may be involved in the transcriptional regulation of mammalian genes	625573
gene_transcript	contains several GAGA repeats upstream of the main GAGA box that may be involved in the transcriptional regulation of mammalian genes	628482

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

RGD Manual Annotations

Imported Annotations - KEGG (archival)