Advanced Search (OLGA)

Gene: Atp5mk (ATP synthase membrane subunit K) Rattus norvegicus

Analyze

Symbol:

Atp5mk

Name:

ATP synthase membrane subunit K

RGD ID:

631426

Description:

Part of proton-transporting ATP synthase complex. Human ortholog(s) of this gene implicated in mitochondrial complex V (ATP synthase) deficiency nuclear type 6. Orthologous to human ATP5MK (ATP synthase membrane subunit k); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ATP synthase F(0) complex subunit k, mitochondrial; ATP synthase membrane subunit DAPIT; ATP synthase membrane subunit DAPIT, mitochondrial; ATP synthase membrane subunit K, mitochondrial; Atp5md; Dapit; diabetes-associated protein in insulin-sensitive tissues; up-regulated during skeletal muscle growth 5 homolog; up-regulated during skeletal muscle growth 5 homolog (mouse); up-regulated during skeletal muscle growth protein 5; upregulated during skeletal muscle growth 5; Usmg5

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ATP5MK (ATP synthase membrane subunit k)	RGD	RGD
Mus musculus (house mouse):	Atp5mk (ATP synthase membrane subunit k)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Atp5mk (ATP synthase membrane subunit k)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ATP5MK (ATP synthase membrane subunit k)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ATP5MK (ATP synthase membrane subunit k)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Atp5mk (ATP synthase membrane subunit k)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ATP5MK (ATP synthase membrane subunit k)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ATP5MK (ATP synthase membrane subunit k)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Atp5mk (ATP synthase membrane subunit k)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Atp5mk (ATP synthase membrane subunit k)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Atp5mk (ATP synthase membrane subunit k)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ATP5MK (ATP synthase membrane subunit k)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	atp5md	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	atp5md	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Neb-cGP	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Neb-cGP	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	CG15459	Alliance	DIOPT (OrthoInspector\|PANTHER\|PhylomeDB)

Related Pseudogenes:

Atp5mk-ps2

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	255,915,255 - 255,922,185 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	86,708,976 - 86,709,152 (-)	Ensembl				GRCr8
GRCr8 Ensembl	1	255,915,259 - 255,922,106 (-)	Ensembl				GRCr8
mRatBN7.2	1	245,973,910 - 245,980,702 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	86,208,712 - 86,208,888 (-)	Ensembl				mRatBN7.2
mRatBN7.2 Ensembl	1	245,973,914 - 245,980,761 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	175,153,998 - 175,154,310 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	182,340,041 - 182,340,353 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	253,442,979 - 253,449,821 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	266,859,961 - 266,866,753 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	266,862,579 - 266,862,842 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	274,290,372 - 274,297,164 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	252,406,530 - 252,413,322 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	241,745,565 - 241,752,358 (-)	NCBI		Celera
Cytogenetic Map	1	q54	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

mitochondrial complex V (ATP synthase) deficiency nuclear type 6 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4,4'-trichlorobiphenyl (ISO)

2-hydroxypropanoic acid (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aconitine (EXP)

aflatoxin B1 (EXP)

amitrole (EXP)

ammonium chloride (EXP)

arsenite(3-) (ISO)

azoxystrobin (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

CGP 52608 (ISO)

cisplatin (EXP,ISO)

copper atom (ISO)

copper(0) (ISO)

corosolic acid (ISO)

cypermethrin (ISO)

dibenzo[a,l]pyrene (ISO)

dibutyl phthalate (EXP)

dicrotophos (ISO)

dioxygen (ISO)

disulfiram (ISO)

doxorubicin (ISO)

ethanol (ISO)

eugenol (EXP)

flutamide (EXP)

folic acid (ISO)

hydrogen peroxide (ISO)

ivermectin (ISO)

methimazole (EXP)

methylparaben (ISO)

ozone (EXP)

PCB138 (ISO)

phenobarbital (ISO)

pyrimidifen (ISO)

rac-lactic acid (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

tetrachloromethane (EXP)

titanium dioxide (ISO)

tolcapone (EXP)

toluene (EXP)

triphenyl phosphate (ISO)

trovafloxacin (ISO)

tungsten (ISO)

valproic acid (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

mitochondrial membrane (IEA)

mitochondrion (ISO)

proton-transporting ATP synthase complex (IBA,IDA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Association of two proteolipids of unknown function with ATP synthase from bovine heart mitochondria.	Chen R, etal., FEBS Lett. 2007 Jul 10;581(17):3145-8. Epub 2007 Jun 8.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Identification of two proteins associated with mammalian ATP synthase.	Meyer B, etal., Mol Cell Proteomics. 2007 Oct;6(10):1690-9. Epub 2007 Jun 17.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	DAPIT, a novel protein down-regulated in insulin-sensitive tissues in streptozotocin-induced diabetes.	Paivarinne H and Kainulainen H, Acta Diabetol 2001;38(2):83-6.
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12865426	PMID:14651853	PMID:18614015	PMID:22688299	PMID:23376485	PMID:29476059	PMID:29917077

Genomics

Comparative Map Data

Atp5mk
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	255,915,255 - 255,922,185 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	86,708,976 - 86,709,152 (-)	Ensembl				GRCr8
GRCr8 Ensembl	1	255,915,259 - 255,922,106 (-)	Ensembl				GRCr8
mRatBN7.2	1	245,973,910 - 245,980,702 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	86,208,712 - 86,208,888 (-)	Ensembl				mRatBN7.2
mRatBN7.2 Ensembl	1	245,973,914 - 245,980,761 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	175,153,998 - 175,154,310 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	182,340,041 - 182,340,353 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	253,442,979 - 253,449,821 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	266,859,961 - 266,866,753 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	266,862,579 - 266,862,842 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	274,290,372 - 274,297,164 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	252,406,530 - 252,413,322 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	241,745,565 - 241,752,358 (-)	NCBI		Celera
Cytogenetic Map	1	q54	NCBI

ATP5MK
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	103,389,050 - 103,396,475 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	103,388,991 - 103,396,492 (-)	Ensembl			hg38	GRCh38
GRCh37	10	105,148,807 - 105,156,232 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	105,138,804 - 105,146,213 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	10	105,138,803 - 105,146,213	NCBI
Celera	10	98,888,747 - 98,896,156 (-)	NCBI		Celera
Cytogenetic Map	10	q24.33	NCBI
HuRef	10	98,779,600 - 98,787,063 (-)	NCBI		HuRef
CHM1_1	10	105,432,926 - 105,440,389 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	10	104,276,349 - 104,283,775 (-)	NCBI		T2T-CHM13v2.0

Atp5mk
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	47,071,910 - 47,079,086 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	47,071,903 - 47,079,086 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	19	47,083,471 - 47,090,647 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	47,083,464 - 47,090,647 (-)	Ensembl			mm10	GRCm38
MGSCv37	19	47,157,961 - 47,165,115 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	19	47,136,782 - 47,143,936 (-)	NCBI		MGSCv36	mm8
Celera	19	47,852,512 - 47,859,670 (-)	NCBI		Celera
Cytogenetic Map	19	C3	NCBI
cM Map	19	39.23	NCBI

Atp5mk
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955485	7,152,426 - 7,159,211 (+)	Ensembl
ChiLan1.0	NW_004955485	7,152,421 - 7,159,211 (+)	NCBI	ChiLan1.0	ChiLan1.0

ATP5MK
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	115,273,511 - 115,281,011 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	115,278,840 - 115,286,340 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	99,986,940 - 99,994,447 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	103,447,873 - 103,455,541 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	103,447,873 - 103,455,044 (-)	Ensembl			panPan2	panpan1.1

ATP5MK
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	28	15,761,732 - 15,767,892 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	40,605,100 - 40,605,276 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	28	15,933,701 - 15,939,869 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	28	16,237,967 - 16,244,133 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	28	16,237,971 - 16,243,999 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	28	15,787,022 - 15,793,201 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	28	15,814,747 - 15,820,916 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	28	15,953,422 - 15,959,588 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Atp5mk
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	31,073,151 - 31,079,830 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936600	2,676,387 - 2,684,780 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936600	2,676,423 - 2,683,055 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ATP5MK
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	114,321,622 - 114,327,485 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	114,321,616 - 114,327,517 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

ATP5MK
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	96,432,664 - 96,442,110 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	96,432,668 - 96,442,067 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666048	57,550,425 - 57,557,945 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Atp5mk
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624831	2,625,021 - 2,633,132 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Atp5mk
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	46,616,680 - 46,623,159 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Atp5mk
55 total Variants

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	160111531	262090437	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	266453731	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	186658830	266453731	Rat
2293674	Bss39	Bone structure and strength QTL 39	7.1	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	1	210980612	255980612	Rat
61327	Eae7	Experimental allergic encephalomyelitis QTL 7	5.6		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	226175591	270518180	Rat
1578775	Iddm21	Insulin dependent diabetes mellitus QTL 21	4.13		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	245782829	270518180	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	205233991	267096252	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	218829748	263829748	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	186658830	266453731	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	205233991	267096252	Rat
631837	Niddm35	Non-insulin dependent diabetes mellitus QTL 35		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	248619887	269633915	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	176288899	270518180	Rat
631836	Stl31	Serum triglyceride level QTL 31	4.64	5e-06	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	247133834	270518180	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	162548015	270518180	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	205233991	267096252	Rat
2293694	Bss38	Bone structure and strength QTL 38	7.05	0.0001	femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	1	210980612	255980612	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	152919152	268496042	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	160111531	262090437	Rat
1300108	Rf8	Renal function QTL 8	3.75		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	1	237995023	269633915	Rat
734767	Niddm57	Non-insulin dependent diabetes mellitus QTL 57			body mass (VT:0001259)	body weight (CMO:0000012)	1	233480549	270108840	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	200449456	256003563	Rat
631215	Stl8	Serum triglyceride level QTL 8	9.27	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	1	234540191	270518180	Rat
631843	Bw116	Body weight QTL 116	4.1	0.016	abdominal adipose amount (VT:1000220)	abdominal fat pad weight (CMO:0000088)	1	233480549	270108840	Rat
731175	Uae20	Urinary albumin excretion QTL 20	3.5	0.0018	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	207163993	269633915	Rat
2300175	Bmd40	Bone mineral density QTL 40	15.4	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	1	210980612	255980612	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
724538	Kidm1	Kidney mass QTL 1	3.2		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	223134011	262090599	Rat
2293655	Bss36	Bone structure and strength QTL 36	10.66	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	210980612	255980612	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	160111426	262090599	Rat
734769	Niddm58	Non-insulin dependent diabetes mellitus QTL 58			body mass (VT:0001259)	body weight (CMO:0000012)	1	225108840	270108840	Rat
724533	Rf51	Renal function QTL 51	5.3	0.0002	kidney plasma flow trait (VT:0005524)	renal plasma flow (CMO:0001914)	1	228180370	266453608	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	154961463	266453731	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	208479811	269633915	Rat
70211	Niddm24	Non-insulin dependent diabetes mellitus QTL 24	3.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	224633915	269633915	Rat
724552	Glom2	Glomerulus QTL 2	3.3	0.0001	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	1	232312773	270518180	Rat
1358916	Kidm22	Kidney mass QTL 22	3.32		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	212738576	257738576	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	194786607	262083703	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
2293700	Bmd27	Bone mineral density QTL 27	6.6	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	210980612	255980612	Rat
2293701	Bmd34	Bone mineral density QTL 34	8.3	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	1	210980612	255980612	Rat
7387289	Uae45	Urinary albumin excretion QTL 45	2.86	0.0021	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	233204160	270518180	Rat
1598839	Rf56	Renal function QTL 56			renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	255849111	270518180	Rat
1581544	Rf52	Renal function QTL 52		0.05	urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	1	241569529	269633915	Rat
1600363	Hc6	Hypercalciuria QTL 6	2.7		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	210980612	255980612	Rat
631536	Lnnr2	Liver neoplastic nodule remodeling QTL 2	2.9	0.0005	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	1	243953669	270518180	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	185857683	270518180	Rat
2302040	Pia35	Pristane induced arthritis QTL 35	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	226175591	270518180	Rat
631669	Iddm9	Insulin dependent diabetes mellitus QTL 9	2.8	0.039	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	233349180	270518180	Rat
7394701	Uae46	Urinary albumin excretion QTL 46	3.6	0.0056	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	210980612	255980612	Rat
1598821	Rf55	Renal function QTL 55	6.3		renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	228174566	270518180	Rat

Markers in Region

RH128718

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	245,973,628 - 245,973,846 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	266,859,680 - 266,859,897	NCBI	Rnor6.0
Rnor_5.0	1	274,290,091 - 274,290,308	UniSTS	Rnor5.0
RGSC_v3.4	1	252,406,249 - 252,406,466	UniSTS	RGSC3.4
Celera	1	241,745,284 - 241,745,501	UniSTS
RH 3.4 Map	1	1631.8	UniSTS
Cytogenetic Map	1	q54	UniSTS

RH137051

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	86,208,703 - 86,208,921 (+)	MAPPER	mRatBN7.2
mRatBN7.2	10	42,211,767 - 42,211,985 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	89,187,263 - 89,187,480	NCBI	Rnor6.0
Rnor_6.0	10	43,465,374 - 43,465,591	NCBI	Rnor6.0
Rnor_5.0	10	88,985,759 - 88,985,976	UniSTS	Rnor5.0
Rnor_5.0	10	43,262,608 - 43,262,825	UniSTS	Rnor5.0
RGSC_v3.4	10	43,631,779 - 43,631,996	UniSTS	RGSC3.4
RGSC_v3.4	10	90,295,283 - 90,295,500	UniSTS	RGSC3.4
Celera	10	84,926,705 - 84,926,922	UniSTS
Celera	10	41,501,879 - 41,502,096	UniSTS
Cytogenetic Map	10	q32.1	UniSTS
Cytogenetic Map	10	q22	UniSTS
Cytogenetic Map	1	q54	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
24	23	114	261	166	164	107	114	107	8	548	279	11	226	122	143	57	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_133544	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063273884	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC112451	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ271158	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473986	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217274	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217509	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217783	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221212	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223588	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223759	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

NM_133544 ⟹ NP_598228

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	255,915,255 - 255,922,047 (-)	NCBI
mRatBN7.2	1	245,973,910 - 245,980,702 (-)	NCBI
Rnor_6.0	1	266,859,961 - 266,866,753 (-)	NCBI
Rnor_5.0	1	274,290,372 - 274,297,164 (-)	NCBI
RGSC_v3.4	1	252,406,530 - 252,413,322 (-)	RGD
Celera	1	241,745,565 - 241,752,358 (-)	RGD

Sequence:

show sequence

GTGATCGGACGAAGAAGATTGAAGTCATGGCTGGCCCAGAAAGTGATGGCCAATTCCAGTTCAC
TGGTATTAAAAAATATTTCAACTCTTATACCCTCACAGGTAGAATGAATTGTGTCCTGGCCACA
TATGGAGGCATTGCTTTGTTGGTCCTATACTTTAAGTTAAGGCCTAAAAAAACCCCAGCTGTGA
AAGCAACATAAATGGATTTTGAAATGTCTGGCCTTATCTGTTAAGTCCCACGCCTGAAGAAGCT
GATGTGAACTCATCATGTAATACTCAATTTGTACAATAAATTATGAACCTGGAAAAAAAAAAAA
AA

hide sequence

RefSeq Acc Id:

XM_063273884 ⟹ XP_063129954

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	255,917,542 - 255,922,185 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_598228	(Get FASTA)	NCBI Sequence Viewer
	XP_063129954	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAB71156	(Get FASTA)	NCBI Sequence Viewer
	EDL94369	(Get FASTA)	NCBI Sequence Viewer
	EDL94370	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000027496
	ENSRNOP00000027496.2
	ENSRNOP00000093868.1
GenBank Protein	Q9JJW3	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_598228 ⟸ NM_133544
- UniProtKB:	Q9JJW3 (UniProtKB/Swiss-Prot), A6JHP6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAGPESDGQFQFTGIKKYFNSYTLTGRMNCVLATYGGIALLVLYFKLRPKKTPAVKAT hide sequence

RefSeq Acc Id:	XP_063129954 ⟸ XM_063273884
- Peptide Label:	isoform X1
- UniProtKB:	Q9JJW3 (UniProtKB/Swiss-Prot), A6JHP6 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9JJW3-F1-model_v2	AlphaFold	Q9JJW3	1-58	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:631426	AgrOrtholog
BioCyc Gene	G2FUF-55491	BioCyc
Ensembl Genes	ENSRNOG00000020296	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00000067471	Ensembl, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000027496	ENTREZGENE
	ENSRNOT00000027496.6	UniProtKB/Swiss-Prot
	ENSRNOT00000100748.1	UniProtKB/Swiss-Prot
InterPro	USMG5	UniProtKB/Swiss-Prot
KEGG Report	rno:171069	UniProtKB/Swiss-Prot
NCBI Gene	171069	ENTREZGENE
PANTHER	ATP SYNTHASE MEMBRANE SUBUNIT K, MITOCHONDRIAL	UniProtKB/Swiss-Prot
	PTHR34038	UniProtKB/Swiss-Prot
Pfam	ATP_synth_reg	UniProtKB/Swiss-Prot
PhenoGen	Atp5mk	PhenoGen
PRINTS	DAPIT	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000020296	RatGTEx
	ENSRNOG00000067471	RatGTEx
UniProt	A6JHP6	ENTREZGENE, UniProtKB/TrEMBL
	ATPMD_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-07-07	Atp5mk	ATP synthase membrane subunit K	Atp5mk	ATP synthase membrane subunit k	Name changed	629549	APPROVED
2020-12-10	Atp5mk	ATP synthase membrane subunit k	Atp5md	ATP synthase membrane subunit DAPIT	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2017-12-01	Atp5md	ATP synthase membrane subunit DAPIT	Usmg5	up-regulated during skeletal muscle growth 5 homolog (mouse)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-12-15	Usmg5	up-regulated during skeletal muscle growth 5 homolog (mouse)	Usmg5	upregulated during skeletal muscle growth 5	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Usmg5	upregulated during skeletal muscle growth 5	Dapit	diabetes-associated protein in insulin-sensitive tissues	Symbol and Name updated	1299863	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_domains	one putative transmembrane domain	727239
gene_protein	58 aminoacids	727239

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM