Symbol:
Lat2
Name:
linker for activation of T cells family, member 2
RGD ID:
631397
Description:
Predicted to enable SH2 domain binding activity. Predicted to be involved in B cell activation; B cell receptor signaling pathway; and calcium-mediated signaling. Predicted to be located in membrane raft. Predicted to be active in plasma membrane. Human ortholog(s) of this gene implicated in Williams-Beuren syndrome. Orthologous to human LAT2 (linker for activation of T cells family member 2); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LAT-2 like; linker for activation of B-cells; linker for activation of T-cells family member 2; non-T cell activation linker; non-T-cell activation linker; Ntal; Wbscr5; Williams-Beuren syndrome chromosome region 5 homolog; Williams-Beuren syndrome chromosome region 5 homolog (human); Williams-Beuren syndrome chromosome region 5-like protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
LAT2 (linker for activation of T cells family member 2) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Lat2 (linker for activation of T cells family, member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Lat2 (linker for activation of T cells family member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LAT2 (linker for activation of T cells family member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
LAT2 (linker for activation of T cells family member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Lat2 (linker for activation of T cells family member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
LAT2 (linker for activation of T cells family member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LAT2 (linker for activation of T cells family member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Lat2 (linker for activation of T cells family member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
LAT2 (linker for activation of T cells family member 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Lat2 (linker for activation of T cells family, member 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 27,740,647 - 27,754,760 (+) NCBI GRCr8 mRatBN7.2 12 22,104,173 - 22,118,294 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 22,104,219 - 22,118,288 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 23,252,803 - 23,259,102 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 23,863,886 - 23,870,183 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 22,930,369 - 22,936,714 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 25,114,099 - 25,128,381 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 25,119,355 - 25,125,749 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 27,114,507 - 27,128,775 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 23,174,554 - 23,180,908 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 23,035,110 - 23,041,465 (+) NCBI Celera 12 23,873,387 - 23,879,734 (+) NCBI Celera Cytogenetic Map 12 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Lat2 Rat 1,2-dimethylhydrazine increases expression ISO Lat2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of LAT2 mRNA CTD PMID:22206623 Lat2 Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of LAT2 mRNA CTD PMID:32741896 Lat2 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of LAT2 mRNA CTD PMID:32741896 Lat2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Lat2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of LAT2 mRNA CTD PMID:21570461 Lat2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of LAT2 mRNA CTD PMID:33387578 Lat2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of LAT2 mRNA CTD PMID:34747641 Lat2 Rat 2-bromohexadecanoic acid decreases expression ISO LAT2 (Homo sapiens) 6480464 2-bromopalmitate results in decreased expression of LAT2 protein CTD PMID:23001822 Lat2 Rat 8-Br-cAMP increases expression ISO LAT2 (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of LAT2 mRNA CTD PMID:22079614 Lat2 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of LAT2 mRNA CTD PMID:31881176 Lat2 Rat acrolein multiple interactions ISO LAT2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of LAT2 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of LAT2 mRNA CTD PMID:32699268 Lat2 Rat acrylamide increases expression ISO LAT2 (Homo sapiens) 6480464 Acrylamide results in increased expression of LAT2 mRNA CTD PMID:32763439 Lat2 Rat aflatoxin B1 increases methylation ISO LAT2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of LAT2 intron CTD PMID:30157460 Lat2 Rat all-trans-retinoic acid decreases expression ISO LAT2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of LAT2 mRNA CTD PMID:23724009 Lat2 Rat all-trans-retinoic acid multiple interactions ISO LAT2 (Homo sapiens) 6480464 LAT2 protein inhibits the reaction [Tretinoin results in increased expression of ITGAM protein] and LAT2 protein inhibits the reaction [Tretinoin results in increased expression of ITGAX protein] CTD PMID:32587277 Lat2 Rat alpha-pinene multiple interactions ISO LAT2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of LAT2 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of LAT2 mRNA CTD PMID:32699268 Lat2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of LAT2 mRNA CTD PMID:16483693 Lat2 Rat antirheumatic drug decreases expression ISO LAT2 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of LAT2 mRNA CTD PMID:24449571 Lat2 Rat aristolochic acid A increases expression ISO LAT2 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of LAT2 mRNA CTD PMID:33212167 Lat2 Rat arsenous acid decreases expression ISO LAT2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of LAT2 mRNA and Arsenic Trioxide results in decreased expression of LAT2 protein CTD PMID:19128835 and PMID:32587277 Lat2 Rat arsenous acid decreases response to substance ISO LAT2 (Homo sapiens) 6480464 LAT2 protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:23001822 Lat2 Rat Azoxymethane multiple interactions ISO Lat2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of LAT2 mRNA CTD PMID:29950665 Lat2 Rat benzo[a]pyrene decreases expression ISO LAT2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of LAT2 mRNA CTD PMID:20064835 and PMID:32234424 Lat2 Rat benzo[a]pyrene increases methylation ISO LAT2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of LAT2 promoter CTD PMID:27901495 Lat2 Rat benzo[a]pyrene increases expression ISO Lat2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of LAT2 mRNA CTD PMID:22228805 Lat2 Rat beta-lapachone increases expression ISO LAT2 (Homo sapiens) 6480464 beta-lapachone results in increased expression of LAT2 mRNA CTD PMID:38218311 Lat2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of LAT2 mRNA CTD PMID:25181051 more ... Lat2 Rat bisphenol A increases methylation ISO Lat2 (Mus musculus) 6480464 bisphenol A results in increased methylation of LAT2 promoter CTD PMID:27312807 Lat2 Rat buta-1,3-diene decreases expression ISO Lat2 (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of LAT2 mRNA CTD PMID:29038090 Lat2 Rat butanal increases expression ISO LAT2 (Homo sapiens) 6480464 butyraldehyde results in increased expression of LAT2 mRNA CTD PMID:26079696 Lat2 Rat cadmium atom multiple interactions ISO LAT2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of LAT2 mRNA CTD PMID:35301059 Lat2 Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of LAT2 promoter CTD PMID:22457795 Lat2 Rat cadmium dichloride multiple interactions ISO LAT2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of LAT2 mRNA CTD PMID:35301059 Lat2 Rat calcitriol multiple interactions ISO LAT2 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of LAT2 mRNA CTD PMID:21592394 Lat2 Rat calcitriol increases expression ISO LAT2 (Homo sapiens) 6480464 Calcitriol results in increased expression of LAT2 mRNA CTD PMID:21592394 Lat2 Rat carbon nanotube increases expression ISO Lat2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Lat2 Rat chloroquine increases response to substance ISO LAT2 (Homo sapiens) 6480464 LAT2 protein results in increased susceptibility to Chloroquine CTD PMID:32587277 Lat2 Rat chlorpyrifos decreases expression ISO LAT2 (Homo sapiens) 6480464 Chlorpyrifos results in decreased expression of LAT2 mRNA CTD PMID:26299976 Lat2 Rat chlorpyrifos decreases response to substance ISO LAT2 (Homo sapiens) 6480464 LAT2 gene mutant form results in decreased susceptibility to Chlorpyrifos CTD PMID:26299976 Lat2 Rat choline multiple interactions ISO Lat2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of LAT2 mRNA CTD PMID:20938992 Lat2 Rat copper(II) sulfate increases expression ISO LAT2 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of LAT2 mRNA CTD PMID:19549813 Lat2 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of LAT2 mRNA CTD PMID:27523638 Lat2 Rat DDE decreases expression ISO LAT2 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of LAT2 mRNA CTD PMID:38568856 Lat2 Rat dextran sulfate multiple interactions ISO Lat2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of LAT2 mRNA CTD PMID:29950665 Lat2 Rat diarsenic trioxide decreases response to substance ISO LAT2 (Homo sapiens) 6480464 LAT2 protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:23001822 Lat2 Rat diarsenic trioxide decreases expression ISO LAT2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of LAT2 mRNA and Arsenic Trioxide results in decreased expression of LAT2 protein CTD PMID:19128835 and PMID:32587277 Lat2 Rat ethyl methanesulfonate decreases expression ISO LAT2 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of LAT2 mRNA CTD PMID:23649840 Lat2 Rat folic acid multiple interactions ISO Lat2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of LAT2 mRNA CTD PMID:20938992 Lat2 Rat formaldehyde decreases expression ISO LAT2 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of LAT2 mRNA CTD PMID:23649840 Lat2 Rat FR900359 increases phosphorylation ISO LAT2 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of LAT2 protein CTD PMID:37730182 Lat2 Rat graphite affects expression EXP 6480464 Graphite affects the expression of LAT2 mRNA CTD PMID:29933104 Lat2 Rat ixazomib multiple interactions ISO LAT2 (Homo sapiens) 6480464 ixazomib inhibits the reaction [10-(octyloxy)decyl-2-(trimethylammonium)ethyl phosphate results in decreased expression of LAT2 protein] and ixazomib inhibits the reaction [perifosine results in decreased expression of LAT2 protein] CTD PMID:23001822 Lat2 Rat L-methionine multiple interactions ISO Lat2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of LAT2 mRNA CTD PMID:20938992 Lat2 Rat lead diacetate increases expression ISO Lat2 (Mus musculus) 6480464 lead acetate results in increased expression of LAT2 mRNA CTD PMID:20542052 Lat2 Rat lead(0) decreases expression ISO LAT2 (Homo sapiens) 6480464 Lead results in decreased expression of LAT2 mRNA CTD PMID:19921347 Lat2 Rat methyl beta-cyclodextrin multiple interactions ISO LAT2 (Homo sapiens) 6480464 methyl-beta-cyclodextrin promotes the reaction [10-(octyloxy)decyl-2-(trimethylammonium)ethyl phosphate results in decreased expression of LAT2 protein] CTD PMID:23001822 Lat2 Rat methyl methanesulfonate decreases expression ISO LAT2 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of LAT2 mRNA CTD PMID:23649840 Lat2 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO LAT2 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [10-(octyloxy)decyl-2-(trimethylammonium)ethyl phosphate results in decreased expression of LAT2 protein] CTD PMID:23001822 Lat2 Rat nickel atom increases expression ISO LAT2 (Homo sapiens) 6480464 Nickel results in increased expression of LAT2 mRNA CTD PMID:25583101 Lat2 Rat nitrates multiple interactions ISO Lat2 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of LAT2 mRNA CTD PMID:35964746 Lat2 Rat O-methyleugenol decreases expression ISO LAT2 (Homo sapiens) 6480464 methyleugenol results in decreased expression of LAT2 mRNA CTD PMID:32234424 Lat2 Rat ozone multiple interactions ISO LAT2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of LAT2 mRNA more ... CTD PMID:32699268 Lat2 Rat ozone multiple interactions ISO Lat2 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of LAT2 mRNA CTD PMID:34911549 Lat2 Rat paracetamol affects expression ISO Lat2 (Mus musculus) 6480464 Acetaminophen affects the expression of LAT2 mRNA CTD PMID:17562736 Lat2 Rat paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of LAT2 mRNA CTD PMID:33387578 Lat2 Rat paraoxon increases expression ISO LAT2 (Homo sapiens) 6480464 Paraoxon results in increased expression of LAT2 mRNA CTD PMID:24413757 Lat2 Rat pentanal increases expression ISO LAT2 (Homo sapiens) 6480464 pentanal results in increased expression of LAT2 mRNA CTD PMID:26079696 Lat2 Rat perifosine multiple interactions ISO LAT2 (Homo sapiens) 6480464 ixazomib inhibits the reaction [perifosine results in decreased expression of LAT2 protein] more ... CTD PMID:23001822 and PMID:32587277 Lat2 Rat perifosine decreases response to substance ISO LAT2 (Homo sapiens) 6480464 LAT2 protein results in decreased susceptibility to perifosine CTD PMID:23001822 Lat2 Rat perifosine decreases expression ISO LAT2 (Homo sapiens) 6480464 perifosine results in decreased expression of LAT2 protein CTD PMID:23001822 Lat2 Rat pirinixic acid multiple interactions ISO LAT2 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of LAT2 mRNA CTD PMID:19710929 Lat2 Rat propanal increases expression ISO LAT2 (Homo sapiens) 6480464 propionaldehyde results in increased expression of LAT2 mRNA CTD PMID:26079696 Lat2 Rat reactive oxygen species decreases abundance ISO LAT2 (Homo sapiens) 6480464 LAT2 protein results in decreased abundance of Reactive Oxygen Species CTD PMID:32587277 Lat2 Rat resveratrol multiple interactions ISO LAT2 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of LAT2 mRNA CTD PMID:23557933 Lat2 Rat silicon dioxide increases expression ISO LAT2 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of LAT2 mRNA CTD PMID:23806026 Lat2 Rat silicon dioxide increases expression ISO Lat2 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of LAT2 mRNA CTD PMID:29203145 Lat2 Rat sirolimus increases response to substance ISO LAT2 (Homo sapiens) 6480464 LAT2 protein results in increased susceptibility to Sirolimus CTD PMID:32587277 Lat2 Rat sodium arsenite increases expression ISO LAT2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of LAT2 mRNA CTD PMID:38568856 Lat2 Rat sodium dichromate decreases expression ISO LAT2 (Homo sapiens) 6480464 sodium bichromate results in decreased expression of LAT2 mRNA CTD PMID:17685462 Lat2 Rat sotorasib multiple interactions ISO LAT2 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of LAT2 mRNA CTD PMID:36139627 Lat2 Rat temozolomide decreases expression ISO LAT2 (Homo sapiens) 6480464 Temozolomide results in decreased expression of LAT2 mRNA CTD PMID:31758290 Lat2 Rat testosterone increases expression ISO LAT2 (Homo sapiens) 6480464 Testosterone results in increased expression of LAT2 mRNA CTD PMID:21592394 Lat2 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of LAT2 mRNA CTD PMID:32741896 Lat2 Rat testosterone multiple interactions ISO LAT2 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of LAT2 mRNA CTD PMID:21592394 Lat2 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of LAT2 mRNA CTD PMID:31150632 Lat2 Rat Theaflavin 3,3'-digallate affects expression ISO LAT2 (Homo sapiens) 6480464 theaflavin-3 and 3'-digallate affects the expression of LAT2 mRNA CTD PMID:34925699 Lat2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of LAT2 mRNA CTD PMID:34492290 Lat2 Rat titanium dioxide increases expression ISO Lat2 (Mus musculus) 6480464 titanium dioxide results in increased expression of LAT2 mRNA CTD PMID:23557971 and PMID:27760801 Lat2 Rat titanium dioxide multiple interactions ISO Lat2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of LAT2 mRNA CTD PMID:29950665 Lat2 Rat titanium dioxide decreases expression ISO Lat2 (Mus musculus) 6480464 titanium dioxide results in decreased expression of LAT2 mRNA CTD PMID:29264374 Lat2 Rat trametinib multiple interactions ISO LAT2 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of LAT2 mRNA CTD PMID:36139627 Lat2 Rat triphenyl phosphate affects expression ISO LAT2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of LAT2 mRNA CTD PMID:37042841 Lat2 Rat valproic acid increases methylation ISO LAT2 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of LAT2 gene CTD PMID:29154799 Lat2 Rat wortmannin multiple interactions ISO LAT2 (Homo sapiens) 6480464 wortmannin inhibits the reaction [[IL3 protein co-treated with CSF2 protein co-treated with FLT3LG protein co-treated with KITLG protein] results in increased expression of LAT2 protein] CTD PMID:23001822
1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP) 17beta-estradiol 3-benzoate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-bromohexadecanoic acid (ISO) 8-Br-cAMP (ISO) acetamide (EXP) acrolein (ISO) acrylamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsenous acid (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) buta-1,3-diene (ISO) butanal (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) calcitriol (ISO) carbon nanotube (ISO) chloroquine (ISO) chlorpyrifos (ISO) choline (ISO) copper(II) sulfate (ISO) Cuprizon (EXP) DDE (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) ethyl methanesulfonate (ISO) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) graphite (EXP) ixazomib (ISO) L-methionine (ISO) lead diacetate (ISO) lead(0) (ISO) methyl beta-cyclodextrin (ISO) methyl methanesulfonate (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) nickel atom (ISO) nitrates (ISO) O-methyleugenol (ISO) ozone (ISO) paracetamol (EXP,ISO) paraoxon (ISO) pentanal (ISO) perifosine (ISO) pirinixic acid (ISO) propanal (ISO) reactive oxygen species (ISO) resveratrol (ISO) silicon dioxide (ISO) sirolimus (ISO) sodium arsenite (ISO) sodium dichromate (ISO) sotorasib (ISO) temozolomide (ISO) testosterone (EXP,ISO) tetrachloromethane (EXP) Theaflavin 3,3'-digallate (ISO) thioacetamide (EXP) titanium dioxide (ISO) trametinib (ISO) triphenyl phosphate (ISO) valproic acid (ISO) wortmannin (ISO)
Lat2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 27,740,647 - 27,754,760 (+) NCBI GRCr8 mRatBN7.2 12 22,104,173 - 22,118,294 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 22,104,219 - 22,118,288 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 23,252,803 - 23,259,102 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 23,863,886 - 23,870,183 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 22,930,369 - 22,936,714 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 25,114,099 - 25,128,381 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 25,119,355 - 25,125,749 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 27,114,507 - 27,128,775 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 23,174,554 - 23,180,908 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 23,035,110 - 23,041,465 (+) NCBI Celera 12 23,873,387 - 23,879,734 (+) NCBI Celera Cytogenetic Map 12 q12 NCBI
LAT2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 74,210,006 - 74,229,834 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 74,199,652 - 74,229,834 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 73,624,336 - 73,644,164 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 73,262,023 - 73,282,100 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 73,068,925 - 73,088,808 NCBI Celera 7 69,103,651 - 69,123,730 (+) NCBI Celera Cytogenetic Map 7 q11.23 NCBI HuRef 7 69,505,694 - 69,525,599 (+) NCBI HuRef CHM1_1 7 73,769,175 - 73,789,226 (+) NCBI CHM1_1 T2T-CHM13v2.0 7 75,412,292 - 75,432,128 (+) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 72,957,159 - 72,977,236 (+) NCBI
Lat2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 134,628,957 - 134,648,637 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 134,628,876 - 134,643,879 (-) Ensembl GRCm39 Ensembl GRCm38 5 134,600,103 - 134,619,783 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 134,600,022 - 134,615,025 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 135,076,135 - 135,090,893 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 134,884,892 - 134,899,650 (-) NCBI MGSCv36 mm8 Celera 5 131,608,314 - 131,623,075 (-) NCBI Celera Cytogenetic Map 5 G2 NCBI cM Map 5 74.7 NCBI
Lat2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955456 13,674,190 - 13,688,611 (-) NCBI ChiLan1.0 ChiLan1.0
LAT2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 90,667,421 - 90,698,260 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 138,932,089 - 138,962,892 (-) NCBI NHGRI_mPanPan1 PanPan1.1 7 81,350,666 - 81,377,115 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 81,350,666 - 81,377,115 (+) Ensembl panpan1.1 panPan2
LAT2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 6,160,939 - 6,175,271 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 6,161,542 - 6,173,294 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 7,859,266 - 7,872,992 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 5,975,446 - 5,989,987 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 5,975,446 - 5,990,000 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 5,966,577 - 5,980,984 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 5,914,054 - 5,928,728 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 6,077,458 - 6,092,227 (-) NCBI UU_Cfam_GSD_1.0
Lat2
LAT2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 11,352,548 - 11,372,101 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 11,353,213 - 11,372,100 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 11,036,844 - 11,055,323 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LAT2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 28 8,848,971 - 8,865,558 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 28 8,848,638 - 8,865,574 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666070 7,714,089 - 7,732,600 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Lat2
.
Predicted Target Of
Count of predictions: 64 Count of miRNA genes: 60 Interacting mature miRNAs: 63 Transcripts: ENSRNOT00000034629 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631560 Apr1 Acute phase response QTL 1 6.1 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 19144362 46669029 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 61324 Eae5 Experimental allergic encephalomyelitis QTL 5 14 nervous system integrity trait (VT:0010566) percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402) 12 19610870 46669029 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 1549829 Scl48 Serum cholesterol level QTL 48 5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 12 9603277 46669029 Rat 61331 Eau2 Experimental allergic uveoretinitis QTL 2 0.0005 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 12 8525423 28064601 Rat 737822 Alc10 Alcohol consumption QTL 10 2.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 12 19610870 40218516 Rat 2293684 Bmd26 Bone mineral density QTL 26 4.4 0.0002 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 12 15872653 32974238 Rat 6893681 Bw109 Body weight QTL 109 2.3 0.004 body mass (VT:0001259) body weight (CMO:0000012) 12 1 23297788 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat 10755457 Coatc14 Coat color QTL 14 0.01759 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 12 1 22591684 Rat 1331761 Bp218 Blood pressure QTL 218 2.973 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 45055165 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 1300157 Rf21 Renal function QTL 21 4.4 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 12 9318216 32103380 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 1298081 Cia25 Collagen induced arthritis QTL 25 4.7 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 19610889 35682913 Rat 2300186 Bmd59 Bone mineral density QTL 59 7.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 12 10474137 46669029 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1331755 Bp219 Blood pressure QTL 219 3.041 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 28064557 Rat 70213 Niddm27 Non-insulin dependent diabetes mellitus QTL 27 3.72 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 19835789 38193007 Rat 2306789 Ean6 Experimental allergic neuritis QTL 6 4.9 nervous system integrity trait (VT:0010566) experimental autoimmune neuritis severity score (CMO:0001528) 12 19610870 24139202 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 7411643 Foco20 Food consumption QTL 20 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 20328819 46669029 Rat 5684888 Pia42 Pristane induced arthritis QTL 42 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 19610870 42828880 Rat 1549912 Bp268 Blood pressure QTL 268 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 13182736 46669029 Rat 2302060 Pia37 Pristane induced arthritis QTL 37 6.1 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 13198157 46669029 Rat 1641928 Alcrsp5 Alcohol response QTL 5 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 12 12812385 46669029 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 1581516 Cm56 Cardiac mass QTL 56 4.2 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 12 1 29333307 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 1549902 Bp269 Blood pressure QTL 269 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 13182736 46669029 Rat 61404 Bw120 Body weight QTL 120 5.1 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 12 12351619 46669029 Rat 1331786 Kidm11 Kidney mass QTL 11 3.571 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 12 11073825 24234895 Rat 2293699 Bss49 Bone structure and strength QTL 49 5.61 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 12 10474137 46669029 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 61416 Pia4 Pristane induced arthritis QTL 4 8.4 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 12 13635523 30827399 Rat 631521 Pia12 Pristane induced arthritis QTL 12 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 20259417 23672083 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 61421 Cia12 Collagen induced arthritis QTL 12 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 13635523 35682913 Rat 2303569 Gluco44 Glucose level QTL 44 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 12812385 46669029 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2293086 Iddm30 Insulin dependent diabetes mellitus QTL 30 3.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 8449490 28302290 Rat 631543 Bp83 Blood pressure QTL 83 5.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 15550826 38478808 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
45
111
91
90
59
25
59
6
214
93
91
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000034629 ⟹ ENSRNOP00000031304
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 22,104,219 - 22,118,275 (+) Ensembl Rnor_6.0 Ensembl 12 25,119,355 - 25,125,749 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000093800 ⟹ ENSRNOP00000083189
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 22,104,219 - 22,118,275 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000098558 ⟹ ENSRNOP00000079065
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 22,109,832 - 22,118,288 (+) Ensembl
RefSeq Acc Id:
NM_173840 ⟹ NP_776212
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 27,740,715 - 27,754,760 (+) NCBI mRatBN7.2 12 22,104,242 - 22,118,289 (+) NCBI Rnor_6.0 12 25,119,379 - 25,125,733 (+) NCBI Rnor_5.0 12 27,114,507 - 27,128,775 (+) NCBI RGSC_v3.4 12 23,174,554 - 23,180,908 (+) RGD Celera 12 23,873,387 - 23,879,734 (+) RGD
Sequence:
ATGAATGCCGAGTTGGAGCTGCTGTGGCCACTGTCAGGACTGTTGCTGCTGCTGCTCTTGGGGACCACAGCTTGGCTGTGTGTCCAGTGCTCCCGCCCAGGGGTGAAGAGAAATGAGAAAATCTACGA
hide sequence
RefSeq Acc Id:
XM_017598358 ⟹ XP_017453847
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 27,740,653 - 27,754,755 (+) NCBI mRatBN7.2 12 22,104,179 - 22,118,294 (+) NCBI Rnor_6.0 12 25,119,846 - 25,128,381 (+) NCBI
Sequence:
AAATGTTCCTGCCCTCTGGCCTCAGCTTCCTGAGCCCTGGGATCACAGACCTGTGTCACCACACCCAGCTGACAAGAACCCTCTCAGTGACAGGCAGCTGGAAGGGACAGCCTGGTGGAGTTACAAAG
hide sequence
RefSeq Acc Id:
XM_039089531 ⟹ XP_038945459
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 27,740,654 - 27,754,755 (+) NCBI mRatBN7.2 12 22,104,180 - 22,118,289 (+) NCBI
RefSeq Acc Id:
XM_039089532 ⟹ XP_038945460
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 27,740,647 - 27,751,122 (+) NCBI mRatBN7.2 12 22,104,173 - 22,114,650 (+) NCBI
RefSeq Acc Id:
XM_039089533 ⟹ XP_038945461
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 27,740,647 - 27,751,122 (+) NCBI mRatBN7.2 12 22,104,173 - 22,114,650 (+) NCBI
RefSeq Acc Id:
XM_039089534 ⟹ XP_038945462
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 27,740,691 - 27,754,755 (+) NCBI mRatBN7.2 12 22,104,223 - 22,118,289 (+) NCBI
RefSeq Acc Id:
XR_005491642
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 27,740,648 - 27,751,776 (+) NCBI mRatBN7.2 12 22,104,174 - 22,115,308 (+) NCBI
RefSeq Acc Id:
XR_005491643
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 27,740,648 - 27,751,776 (+) NCBI mRatBN7.2 12 22,104,174 - 22,115,308 (+) NCBI
RefSeq Acc Id:
NP_776212 ⟸ NM_173840
- UniProtKB:
Q8CGL2 (UniProtKB/Swiss-Prot), A6J0I1 (UniProtKB/TrEMBL)
- Sequence:
MNAELELLWPLSGLLLLLLLGTTAWLCVQCSRPGVKRNEKIYEQRNQQENEQSVASSQTYSLARPVRTGLQMDAASNKSFERKNKLLFSHLEGPESPRYQNFYKGSRRESDAAYVDPIPTDYYNWGCF
hide sequence
RefSeq Acc Id:
XP_017453847 ⟸ XM_017598358
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I5ZWF7 (UniProtKB/TrEMBL), A6J0I2 (UniProtKB/TrEMBL)
- Sequence:
MFLPSGLSFLSPGITDLCHHTQLTRTLSVTGSWKGQPGGVTKGRRGSRLQPSPTAPPEFRDTSYAISVLAGVKRNEKIYEQRNQQENEQSVASSQTYSLARPVRTGLQMDAASNKSFERKNKLLFSHL
hide sequence
Ensembl Acc Id:
ENSRNOP00000031304 ⟸ ENSRNOT00000034629
RefSeq Acc Id:
XP_038945460 ⟸ XM_039089532
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038945461 ⟸ XM_039089533
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_038945459 ⟸ XM_039089531
- Peptide Label:
isoform X1
- UniProtKB:
Q8CGL2 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038945462 ⟸ XM_039089534
- Peptide Label:
isoform X5
Ensembl Acc Id:
ENSRNOP00000083189 ⟸ ENSRNOT00000093800
Ensembl Acc Id:
ENSRNOP00000079065 ⟸ ENSRNOT00000098558
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-11-17
Lat2
linker for activation of T cells family, member 2
Symbol and Name updated
1299863 APPROVED
2004-12-14
Wbscr5
Williams-Beuren syndrome chromosome region 5 homolog (human)
Symbol and Name status set to approved
1299863 APPROVED
