Advanced Search (OLGA)

Gene: Eddm3b (epididymal protein 3B) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Eddm3b

Name:

epididymal protein 3B

RGD ID:

631349

Description:

Orthologous to human EDDM3B (epididymal protein 3B); INTERACTS WITH acrylamide; ammonium chloride; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

E3sp; epididymal secretory protein 3; epididymal secretory protein E3-beta; Fam12b; family with sequence similarity 12, member B (epididymal); Re3

RGD Orthologs

Human

Mouse

Bonobo

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	EDDM3B (epididymal protein 3B)	RGD	RGD
Mus musculus (house mouse):	Eddm3b (epididymal protein 3B)	RGD	RGD
Pan paniscus (bonobo/pygmy chimpanzee):	EDDM3B (epididymal protein 3B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	EDDM3A (epididymal protein 3A)	HGNC	Ensembl, Inparanoid, OrthoDB, Panther
Alliance orthologs ³
Homo sapiens (human):	EDDM3B (epididymal protein 3B)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Homo sapiens (human):	EDDM3A (epididymal protein 3A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Eddm3b (epididymal protein 3B)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	26,817,508 - 26,820,274 (+)	NCBI		GRCr8
mRatBN7.2	15	24,343,992 - 24,346,759 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	24,345,573 - 24,346,025 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	27,115,152 - 27,117,918 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	28,074,299 - 28,077,064 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	26,323,713 - 26,326,479 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	28,090,836 - 28,094,548 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	28,090,836 - 28,092,023 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	31,880,764 - 31,881,956 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	27,107,078 - 27,108,270 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	27,122,777 - 27,123,970 (+)	NCBI
Celera	15	24,663,621 - 24,664,808 (+)	NCBI		Celera
Cytogenetic Map	15	p14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Eddm3b	Rat	Brain-Lung-Thyroid Syndrome		ISO	EDDM3B (Homo sapiens)	8554872	ClinVar Annotator: match by term: Brain-lung-thyroid syndrome	ClinVar	PMID:25741868
Eddm3b	Rat	purine nucleoside phosphorylase deficiency		ISO	EDDM3B (Homo sapiens)	8554872	ClinVar Annotator: match by term: Purine-nucleoside phosphorylase deficiency	ClinVar	PMID:24767876 and PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Eddm3b	Rat	acrylamide	decreases expression	EXP		6480464	Acrylamide results in decreased expression of EDDM3B mRNA	CTD	PMID:28959563
Eddm3b	Rat	aflatoxin B1	increases methylation	ISO	EDDM3B (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of EDDM3B gene	CTD	PMID:27153756
Eddm3b	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of EDDM3B mRNA	CTD	PMID:16483693
Eddm3b	Rat	arsane	affects methylation	ISO	EDDM3B (Homo sapiens)	6480464	Arsenic affects the methylation of EDDM3B gene	CTD	PMID:25304211
Eddm3b	Rat	arsenic atom	affects methylation	ISO	EDDM3B (Homo sapiens)	6480464	Arsenic affects the methylation of EDDM3B gene	CTD	PMID:25304211
Eddm3b	Rat	benzo[a]pyrene	decreases methylation	ISO	EDDM3B (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of EDDM3B 5' UTR	CTD	PMID:27901495
Eddm3b	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of EDDM3B mRNA	CTD	PMID:25181051 and PMID:32145629
Eddm3b	Rat	cadmium atom	decreases expression	ISO	EDDM3B (Homo sapiens)	6480464	Cadmium results in decreased expression of EDDM3B mRNA	CTD	PMID:24376830
Eddm3b	Rat	CGP 52608	multiple interactions	ISO	EDDM3B (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to EDDM3B gene]	CTD	PMID:28238834
Eddm3b	Rat	chlordecone	increases expression	ISO	Eddm3b (Mus musculus)	6480464	Chlordecone results in increased expression of EDDM3B mRNA	CTD	PMID:33711761
Eddm3b	Rat	furan	decreases expression	EXP		6480464	furan results in decreased expression of EDDM3B mRNA	CTD	PMID:25539665
Eddm3b	Rat	pioglitazone	multiple interactions	ISO	Eddm3b (Mus musculus)	6480464	[N-nitroso-tris-chloroethylurea co-treated with Pioglitazone] results in decreased expression of EDDM3B mRNA	CTD	PMID:27935865
Eddm3b	Rat	sodium arsenite	decreases expression	ISO	Eddm3b (Mus musculus)	6480464	sodium arsenite results in decreased expression of EDDM3B mRNA	CTD	PMID:36209798 and PMID:37682722
Eddm3b	Rat	Tesaglitazar	decreases expression	EXP		6480464	tesaglitazar results in decreased expression of EDDM3B mRNA	CTD	PMID:21515302

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Eddm3b	Rat	protein binding	enables	ISO	EDDM3B (Homo sapiens)	1624291	UniProtKB:O15393-2 more ...	RGD	PMID:25416956 and PMID:32296183

#	Reference Title	Reference Citation
1.	GOA pipeline	RGD automated data pipeline
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Eddm3b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	26,817,508 - 26,820,274 (+)	NCBI		GRCr8
mRatBN7.2	15	24,343,992 - 24,346,759 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	24,345,573 - 24,346,025 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	27,115,152 - 27,117,918 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	28,074,299 - 28,077,064 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	26,323,713 - 26,326,479 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	28,090,836 - 28,094,548 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	28,090,836 - 28,092,023 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	31,880,764 - 31,881,956 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	27,107,078 - 27,108,270 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	27,122,777 - 27,123,970 (+)	NCBI
Celera	15	24,663,621 - 24,664,808 (+)	NCBI		Celera
Cytogenetic Map	15	p14	NCBI

EDDM3B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	20,768,404 - 20,770,948 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	20,768,404 - 20,770,948 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	21,236,563 - 21,239,107 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	20,306,426 - 20,308,947 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	20,306,425 - 20,308,945	NCBI
Celera	14	1,097,447 - 1,099,968 (+)	NCBI		Celera
Cytogenetic Map	14	q11.2	NCBI
HuRef	14	1,357,581 - 1,360,102 (+)	NCBI		HuRef
CHM1_1	14	21,238,573 - 21,241,094 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	14,965,518 - 14,968,062 (+)	NCBI		T2T-CHM13v2.0

Eddm3b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	51,351,886 - 51,355,248 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	51,351,883 - 51,355,264 (+)	Ensembl		GRCm39 Ensembl
GRCm38	14	51,114,429 - 51,117,791 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	51,114,426 - 51,117,807 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	51,734,240 - 51,737,466 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	50,036,516 - 50,039,742 (+)	NCBI		MGSCv36	mm8
Celera	14	47,409,190 - 47,412,412 (+)	NCBI		Celera
Cytogenetic Map	14	C1	NCBI
cM Map	14	26.38	NCBI

EDDM3B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	22,265,380 - 22,267,910 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	21,481,867 - 21,484,397 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	1,630,027 - 1,632,566 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	19,686,884 - 19,689,433 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	19,688,641 - 19,689,084 (+)	Ensembl	panpan1.1		panPan2

Variants in Eddm3b
35 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	267
Count of miRNA genes:	168
Interacting mature miRNAs:	190
Transcripts:	ENSRNOT00000043941
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331729	Rf42	Renal function QTL 42	3.071		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	15	17362897	73690657	Rat
1641887	Alcrsp14	Alcohol response QTL 14			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	15	1	42356671	Rat
10755503	Bp391	Blood pressure QTL 391	2.37		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	15	20248600	37896129	Rat
1578646	Bmd18	Bone mineral density QTL 18	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	15	22806240	98288169	Rat
9589149	Insul29	Insulin level QTL 29	9.06	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	15	1	34723002	Rat
1578647	Bmd17	Bone mineral density QTL 17	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	15	22806240	98288169	Rat
10401805	Kidm51	Kidney mass QTL 51			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	15	306329	45306329	Rat
2317750	Glom26	Glomerulus QTL 26	4.3		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	15	12496141	65205939	Rat
2298549	Neuinf12	Neuroinflammation QTL 12	3.5		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	15	1	55302115	Rat
8552920	Pigfal8	Plasma insulin-like growth factor 1 level QTL 8	3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	15	1	34723002	Rat
2293688	Bss29	Bone structure and strength QTL 29	5.31	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	15	11111142	56111142	Rat
5685002	Bss103	Bone structure and strength QTL 103	2.8		tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	15	14481165	28469888	Rat
8694361	Abfw6	Abdominal fat weight QTL 6	10.2	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	15	1	34723002	Rat
631273	Lecl2	Lens clarity QTL 2		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	15	10596089	55596089	Rat
2300167	Bmd63	Bone mineral density QTL 63	5.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	15	11111142	56111142	Rat
731170	Pur3	Proteinuria QTL 3	2.3	0.0005	urine protein amount (VT:0005160)	urine protein excretion rate (CMO:0000759)	15	1	41686771	Rat
738017	Hcas7	Hepatocarcinoma susceptibility QTL 7	2.91		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	15	2266368	46921453	Rat
10054130	Srcrt8	Stress Responsive Cort QTL 8	2.18	0.0085	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	15	22117933	67117933	Rat
2300173	Bmd62	Bone mineral density QTL 62	12.8	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	15	11111142	56111142	Rat
2324620	Coatc3	Coat color QTL 3			coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	15	19856566	46187442	Rat
61424	Scl1	Serum cholesterol level QTL 1	7.7	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	15	16725528	80672115	Rat
1582251	Gluco24	Glucose level QTL 24	3.2	0.0008	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	15	5530756	50530756	Rat
1354657	Despr13	Despair related QTL 13		0.0022	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	15	1	29912054	Rat
631550	Bw7	Body weight QTL 7	3.6		body mass (VT:0001259)	body weight (CMO:0000012)	15	19856566	34924750	Rat
1578660	Bss19	Bone structure and strength QTL 19	4.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	15	22806240	98288169	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	9	43	79	75	78	55	18	55	6	193	81	62	42	54	23


RefSeq Transcripts	NM_178103	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC114343	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ515238	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000078966 ⟹ ENSRNOP00000075575

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	24,345,573 - 24,346,025 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000090835 ⟹ ENSRNOP00000069421

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	15	28,090,836 - 28,092,023 (-)	Ensembl

RefSeq Acc Id:

NM_178103 ⟹ NP_835204

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	26,817,508 - 26,820,274 (+)	NCBI
mRatBN7.2	15	24,343,992 - 24,346,759 (+)	NCBI
Rnor_6.0	15	28,090,836 - 28,092,023 (-)	NCBI
Rnor_5.0	15	31,880,764 - 31,881,956 (+)	NCBI
RGSC_v3.4	15	27,107,078 - 27,108,270 (+)	RGD
Celera	15	24,663,621 - 24,664,808 (+)	RGD

Sequence:

show sequence

GGTGGCCCTGGTGCCTGCTATGATGTCCTCTCTAAAAGCCTGGGACACGCTCTTGCTCCTGCTGTGTCTGCAGTATAGCCTACCTGCACAAAGCACCTCCAGGGGGCAGTTCATGGAACAGCATCACC
TAAGTTCAAACGAAGAGTTCAGTGCCTACAGCTGTGACGTCCTCATGACAGAAAAGGCTCTGAGACCGAGGCTCTCACACCCGTTTGTTTATATGACATGGTACAAAGTTGAACATATATGCATTAGT
AGCAACTGGAAAGATCGCTACAAAAATTTATATGTTTGGGCACAGACCCCCATTAAGGTCCTCAGGTGCCAGTGGGAGAACTTAAAAAGTAGATATACAGAGAGAAGGAGTTACAGCTATGTTCAGTT
CCACTGCAATGCTGATGGGTATGTGGACAGCATAGAGGACATGAAGGTTCTAGAGCCCATCTTCATCTAGAAAGTCTCACCAGCTCTAGACGGTTTTGAAAGACCAGTGAGTAGTTCTCAAATGTCAA
CCTCCCTCACACACCCTTAACTCACCCATTGTGCCACCCATCCCCACCCTTTACCCCCTACTGTCCACCTCCTGCTTACAACAGCAACTGTTACTTCTGCTTTGCAATTGTATGTCAGTGTTTTTTAA
TCATTTTGTTTCTCTGGTATTACAGTTGTACTTTTAGGTTCTCCGTCTAAAATATCGTTCCTCCCTTGTCGTTCTCGTGACTCAGCTCTCTGTTCCTGTGACAAAGTGTTTGAGAGAAGCATTCAAGG
GAGCTTTATATGCCTCCCTTCAGCTGTATCTGCTGGCTCTGTTGTCCTGGGGAGGAGTGGGGCAGAGCATTATGGTGGGGAAATGTGAAAGAGCCTCACTCCATACAAGCTGGAAAGTAGGAAGAGAA
GGAAGGGGAAGAGTGTGGAGACGAGATGGTGGCTCCAGTGACTTCCCTACCCGAGCTGGGCCTCCAGATCCACTCAGCTATGAATTCATCCACAGTCAAAGTCATTACAACCTCCATGACCCAAGTGG
CAGATAAGCCTTCAAAACAGGAGCCCATGGGAGGTCATTGGACAGCCAGACCATGGCAGCATCTTCTCTTGACTTATCCAGGATTTTTCCAGATATCGTCTTTATGTCTATCCAAACCGAATGATCGT
CCCTTCCACGAATAAATTGTTATCCACTGTGAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_835204	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAD56200	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000040734.1
	ENSRNOP00000075575
	ENSRNOP00000075575.2

RefSeq Acc Id:	NP_835204 ⟸ NM_178103
- Peptide Label:	precursor
- UniProtKB:	W0UVD2 (UniProtKB/TrEMBL), A6KED6 (UniProtKB/TrEMBL), D4ABQ0 (UniProtKB/TrEMBL), Q8CHN4 (UniProtKB/TrEMBL), W0UTG1 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSSLKAWDTLLLLLCLQYSLPAQSTSRGQFMEQHHLSSNEEFSAYSCDVLMTEKALRPRLSHPFVYMTWYKVEHICISSNWKDRYKNLYVWAQTPIKVLRCQWENLKSRYTERRSYSYVQFHCNADGY VDSIEDMKVLEPIFI hide sequence

Ensembl Acc Id:

ENSRNOP00000069421 ⟸ ENSRNOT00000090835

Ensembl Acc Id:

ENSRNOP00000075575 ⟸ ENSRNOT00000078966

Protein Domains

Ribonuclease A-domain

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4ABQ0-F1-model_v2	AlphaFold	D4ABQ0	1-143	view protein structure
AF-E9PTM0-F1-model_v2	AlphaFold	E9PTM0	1-143	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-14027	BioCyc
Ensembl Genes	ENSRNOG00000030110	UniProtKB/TrEMBL
	ENSRNOG00000052100	Ensembl
	ENSRNOG00000054022	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000050944.2	UniProtKB/TrEMBL
	ENSRNOT00000078966	ENTREZGENE
	ENSRNOT00000078966.2	UniProtKB/TrEMBL
Gene3D-CATH	3.10.130.10	UniProtKB/TrEMBL
InterPro	EDDM3A/EDDM3B	UniProtKB/TrEMBL
	RNaseA-like_dom_sf	UniProtKB/TrEMBL
	RNaseA_domain	UniProtKB/TrEMBL
KEGG Report	rno:290032	UniProtKB/TrEMBL
NCBI Gene	290032	ENTREZGENE
PANTHER	EPIDIDYMAL SECRETORY PROTEIN E3-BETA	UniProtKB/TrEMBL
	PTHR16788	UniProtKB/TrEMBL
Pfam	RnaseA	UniProtKB/TrEMBL
PhenoGen	Eddm3b	PhenoGen
RatGTEx	ENSRNOG00000030110	RatGTEx
	ENSRNOG00000052100	RatGTEx
	ENSRNOG00000054022	RatGTEx
Superfamily-SCOP	RNaseA	UniProtKB/TrEMBL
UniProt	A0A0G2KAY4_RAT	UniProtKB/TrEMBL
	A6KED6	ENTREZGENE, UniProtKB/TrEMBL
	D4ABQ0	ENTREZGENE, UniProtKB/TrEMBL
	Q8CHN4	ENTREZGENE, UniProtKB/TrEMBL
	W0UTG1	ENTREZGENE, UniProtKB/TrEMBL
	W0UVD2	ENTREZGENE
UniProt Secondary	W0UVD2	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-02	Eddm3b	epididymal protein 3B	Fam12b	family with sequence similarity 12, member B (epididymal)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Fam12b	family with sequence similarity 12, member B (epididymal)	E3sp	epididymal secretory protein 3	Symbol and Name updated	1299863	APPROVED
2004-02-11	E3sp	sperm protein 3111	Re3	epididymal secretory protein 3	Symbol updated	625702	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar