Advanced Search (OLGA)

Gene: Npas4 (neuronal PAS domain protein 4) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Npas4

Name:

neuronal PAS domain protein 4

RGD ID:

628866

Description:

Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific; RNA polymerase II cis-regulatory region sequence-specific DNA binding activity; and protein heterodimerization activity. Predicted to be involved in several processes, including chemical postsynaptic transmission; learning or memory; and modulation of chemical synaptic transmission. Predicted to act upstream of or within cellular response to corticosterone stimulus. Predicted to be located in nucleus. Predicted to be part of transcription regulator complex. Orthologous to human NPAS4 (neuronal PAS domain protein 4); INTERACTS WITH 6-propyl-2-thiouracil; alpha-Zearalanol; ammonium chloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

bHLH PAS type transcription factor NXF; bHLH-PAS type transcription factor NXF; HLH-PAS transcription factor NXF; neuronal PAS domain-containing protein 4; neuronal PAS4; Nxf

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NPAS4 (neuronal PAS domain protein 4)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Npas4 (neuronal PAS domain protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Npas4 (neuronal PAS domain protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NPAS4 (neuronal PAS domain protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NPAS4 (neuronal PAS domain protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Npas4 (neuronal PAS domain protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NPAS4 (neuronal PAS domain protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NPAS4 (neuronal PAS domain protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Npas4 (neuronal PAS domain protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	NPAS4 (neuronal PAS domain protein 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Npas4 (neuronal PAS domain protein 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	npas4b (neuronal PAS domain protein 4b)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	npas4a (neuronal PAS domain protein 4a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cky-1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	dysf	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	npas4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	211,710,640 - 211,728,038 (-)	NCBI		GRCr8
mRatBN7.2	1	202,281,260 - 202,298,681 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	202,281,958 - 202,286,724 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	210,634,984 - 210,639,756 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	217,727,377 - 217,732,147 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	210,418,406 - 210,423,176 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	220,260,310 - 220,278,177 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	220,261,008 - 220,265,772 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	227,191,333 - 227,209,087 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	207,597,735 - 207,602,499 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	207,751,187 - 207,755,952 (-)	NCBI
Celera	1	199,821,938 - 199,826,702 (-)	NCBI		Celera
Cytogenetic Map	1	q43	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Npas4	Rat	Aicardi-Goutieres Syndrome 3		ISO	NPAS4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Aicardi-Goutieres syndrome 3	ClinVar	PMID:28492532
Npas4	Rat	Bardet-Biedl syndrome		ISO	NPAS4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Bardet-Biedl syndrome	ClinVar	PMID:12118255 more ...
Npas4	Rat	congenital muscular dystrophy-dystroglycanopathy type A13		ISO	NPAS4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Muscular dystrophy-dystroglycanopathy (congenital with brain and eye anomalies), type A13	ClinVar	PMID:22219654 and PMID:28492532
Npas4	Rat	glycogen storage disease V		ISO	NPAS4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Glycogen storage disease and type V	ClinVar	PMID:12118255 more ...
Npas4	Rat	immunodeficiency 90		ISO	NPAS4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Infections more ...	ClinVar	PMID:28492532
Npas4	Rat	intellectual disability		ISO	NPAS4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar
Npas4	Rat	microcephaly		ISO	NPAS4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Microcephaly	ClinVar	PMID:25741868

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Npas4	Rat	(S)-amphetamine	increases expression	ISO	Npas4 (Mus musculus)	6480464	Dextroamphetamine results in increased expression of NPAS4 mRNA	CTD	PMID:19194377
Npas4	Rat	2,2',4,4'-Tetrabromodiphenyl ether	multiple interactions	ISO	Npas4 (Mus musculus)	6480464	[Flame Retardants results in increased abundance of 2 more ...	CTD	PMID:38995820
Npas4	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Npas4 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the reaction [AHR protein binds to NPAS4 promoter]	CTD	PMID:19654925
Npas4	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	Npas4 (Mus musculus)	6480464	bisphenol S affects the methylation of NPAS4 gene	CTD	PMID:31683443
Npas4	Rat	5-aza-2'-deoxycytidine	increases expression	ISO	NPAS4 (Homo sapiens)	6480464	Decitabine results in increased expression of NPAS4 mRNA	CTD	PMID:21856257
Npas4	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of NPAS4 mRNA	CTD	PMID:24780913
Npas4	Rat	aflatoxin B1	decreases methylation	ISO	NPAS4 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased methylation of NPAS4 gene	CTD	PMID:27153756
Npas4	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of NPAS4 mRNA	CTD	PMID:35163327
Npas4	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of NPAS4 mRNA	CTD	PMID:16483693
Npas4	Rat	benzo[a]pyrene	multiple interactions	ISO	Npas4 (Mus musculus)	6480464	Benzo(a)pyrene promotes the reaction [AHR protein binds to NPAS4 promoter]	CTD	PMID:19654925
Npas4	Rat	benzo[a]pyrene	increases methylation	ISO	NPAS4 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of NPAS4 promoter	CTD	PMID:27901495
Npas4	Rat	benzo[a]pyrene	affects methylation	ISO	NPAS4 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of NPAS4 3' UTR	CTD	PMID:27901495
Npas4	Rat	benzo[a]pyrene	increases expression	ISO	Npas4 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of NPAS4 mRNA	CTD	PMID:22228805
Npas4	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	NPAS4 (Homo sapiens)	6480464	Diethylhexyl Phthalate results in decreased expression of NPAS4 mRNA	CTD	PMID:31163220
Npas4	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of NPAS4 mRNA	CTD	PMID:25181051
Npas4	Rat	bisphenol A	decreases expression	ISO	Npas4 (Mus musculus)	6480464	bisphenol A results in decreased expression of NPAS4 mRNA	CTD	PMID:32156529
Npas4	Rat	dieldrin	increases expression	ISO	NPAS4 (Homo sapiens)	6480464	Dieldrin results in increased expression of NPAS4 mRNA	CTD	PMID:31068361
Npas4	Rat	dimethylarsinic acid	multiple interactions	ISO	Npas4 (Mus musculus)	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of NPAS4 mRNA	CTD	PMID:34876320
Npas4	Rat	dorsomorphin	multiple interactions	ISO	NPAS4 (Homo sapiens)	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ...	CTD	PMID:27188386
Npas4	Rat	entinostat	decreases expression	ISO	NPAS4 (Homo sapiens)	6480464	entinostat results in decreased expression of NPAS4 mRNA	CTD	PMID:26272509
Npas4	Rat	entinostat	multiple interactions	ISO	NPAS4 (Homo sapiens)	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of NPAS4 mRNA	CTD	PMID:27188386
Npas4	Rat	glycidol	decreases expression	EXP		6480464	glycidol results in decreased expression of NPAS4 mRNA	CTD	PMID:24395379 and PMID:24915197
Npas4	Rat	glyphosate	increases expression	EXP		6480464	Glyphosate results in increased expression of NPAS4 mRNA	CTD	PMID:38314887
Npas4	Rat	lead diacetate	decreases expression	EXP		6480464	lead acetate results in decreased expression of NPAS4 mRNA	CTD	PMID:22641619
Npas4	Rat	methamphetamine	multiple interactions	EXP		6480464	[Methamphetamine co-treated with SCH 23390] results in increased expression of NPAS4 mRNA	CTD	PMID:19564919
Npas4	Rat	methamphetamine	increases expression	EXP		6480464	Methamphetamine results in increased expression of NPAS4 mRNA	CTD	PMID:19564919
Npas4	Rat	methylarsonic acid	multiple interactions	ISO	Npas4 (Mus musculus)	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of NPAS4 mRNA	CTD	PMID:34876320
Npas4	Rat	methylmercury chloride	increases expression	ISO	NPAS4 (Homo sapiens)	6480464	methylmercuric chloride results in increased expression of NPAS4 mRNA	CTD	PMID:28001369
Npas4	Rat	niclosamide	increases expression	ISO	NPAS4 (Homo sapiens)	6480464	Niclosamide results in increased expression of NPAS4 mRNA	CTD	PMID:36318118
Npas4	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of NPAS4 mRNA	CTD	PMID:35163327
Npas4	Rat	phenylmercury acetate	multiple interactions	ISO	NPAS4 (Homo sapiens)	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of NPAS4 mRNA	CTD	PMID:27188386
Npas4	Rat	SB 431542	multiple interactions	ISO	NPAS4 (Homo sapiens)	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ...	CTD	PMID:27188386
Npas4	Rat	SCH 23390	multiple interactions	EXP		6480464	[Methamphetamine co-treated with SCH 23390] results in increased expression of NPAS4 mRNA	CTD	PMID:19564919
Npas4	Rat	silver atom	decreases expression	ISO	Npas4 (Mus musculus)	6480464	Silver results in decreased expression of NPAS4 mRNA	CTD	PMID:27131904
Npas4	Rat	silver(0)	decreases expression	ISO	Npas4 (Mus musculus)	6480464	Silver results in decreased expression of NPAS4 mRNA	CTD	PMID:27131904
Npas4	Rat	sodium arsenate	multiple interactions	ISO	Npas4 (Mus musculus)	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of NPAS4 mRNA	CTD	PMID:34876320
Npas4	Rat	sodium arsenite	multiple interactions	ISO	Npas4 (Mus musculus)	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of NPAS4 mRNA	CTD	PMID:34876320
Npas4	Rat	titanium dioxide	decreases methylation	ISO	Npas4 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of NPAS4 gene and titanium dioxide results in decreased methylation of NPAS4 promoter	CTD	PMID:35295148
Npas4	Rat	titanium dioxide	increases methylation	ISO	Npas4 (Mus musculus)	6480464	titanium dioxide results in increased methylation of NPAS4 promoter	CTD	PMID:35295148
Npas4	Rat	triclosan	decreases expression	ISO	NPAS4 (Homo sapiens)	6480464	Triclosan results in decreased expression of NPAS4 mRNA	CTD	PMID:30510588
Npas4	Rat	triptonide	increases expression	ISO	Npas4 (Mus musculus)	6480464	triptonide results in increased expression of NPAS4 mRNA	CTD	PMID:33045310
Npas4	Rat	valproic acid	decreases expression	ISO	NPAS4 (Homo sapiens)	6480464	Valproic Acid results in decreased expression of NPAS4 mRNA	CTD	PMID:28001369
Npas4	Rat	valproic acid	decreases expression	EXP		6480464	Valproic Acid results in decreased expression of NPAS4 mRNA	CTD	PMID:29427782
Npas4	Rat	vinclozolin	increases expression	EXP		6480464	vinclozolin results in increased expression of NPAS4 mRNA	CTD	PMID:22615374

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Npas4	Rat	cell differentiation	involved_in	IEA	UniProtKB-KW:KW-0221	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Npas4	Rat	cellular response to corticosterone stimulus	acts_upstream_of_or_within	ISO	Npas4 (Mus musculus)	1624291	PMID:20626564	RGD	PMID:20626564
Npas4	Rat	cellular response to corticosterone stimulus	acts_upstream_of_or_within	IEA	UniProtKB:Q8BGD7 and ensembl:ENSMUSP00000062992	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Npas4	Rat	cellular response to stress	acts_upstream_of_or_within	ISO	Npas4 (Mus musculus)	1624291	PMID:20626564	RGD	PMID:20626564
Npas4	Rat	cellular response to stress	acts_upstream_of_or_within	IEA	UniProtKB:Q8BGD7 and ensembl:ENSMUSP00000062992	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Npas4	Rat	excitatory postsynaptic potential	involved_in	ISO	Npas4 (Mus musculus)	1624291	PMID:24855953	RGD	PMID:24855953
Npas4	Rat	excitatory postsynaptic potential	involved_in	IEA	UniProtKB:Q8BGD7 and ensembl:ENSMUSP00000062992	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Npas4	Rat	excitatory postsynaptic potential	involved_in	ISS	UniProtKB:Q8BGD7	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Npas4	Rat	inhibitory postsynaptic potential	involved_in	ISO	Npas4 (Mus musculus)	1624291	PMID:18815592 and PMID:24855953	RGD	PMID:18815592 and PMID:24855953
Npas4	Rat	inhibitory postsynaptic potential	acts_upstream_of_or_within	ISO	Npas4 (Mus musculus)	1624291	MGI:3828100 PMID:24201284	RGD	PMID:24201284
Npas4	Rat	inhibitory postsynaptic potential	acts_upstream_of_or_within	IEA	UniProtKB:Q8BGD7 and ensembl:ENSMUSP00000062992	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Npas4	Rat	inhibitory postsynaptic potential	involved_in	ISS	UniProtKB:Q8BGD7	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Npas4	Rat	inhibitory synapse assembly	involved_in	ISS	UniProtKB:Q8BGD7	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Npas4	Rat	inhibitory synapse assembly	involved_in	IEA	UniProtKB:Q8BGD7 and ensembl:ENSMUSP00000062992	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Npas4	Rat	inhibitory synapse assembly	involved_in	ISO	Npas4 (Mus musculus)	1624291	PMID:18815592	RGD	PMID:18815592
Npas4	Rat	learning	involved_in	ISO	Npas4 (Mus musculus)	1624291	PMID:22194569	RGD	PMID:22194569
Npas4	Rat	learning	involved_in	IEA	UniProtKB:Q8BGD7 and ensembl:ENSMUSP00000062992	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Npas4	Rat	learning	involved_in	ISS	UniProtKB:Q8BGD7	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Npas4	Rat	long-term memory	involved_in	ISO	Npas4 (Mus musculus)	1624291	PMID:22194569 and PMID:23029555	RGD	PMID:22194569 and PMID:23029555
Npas4	Rat	long-term memory	involved_in	IEA	UniProtKB:Q8BGD7 and ensembl:ENSMUSP00000062992	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Npas4	Rat	long-term memory	involved_in	ISS	UniProtKB:Q8BGD7	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Npas4	Rat	nervous system development	involved_in	IEA	UniProtKB-KW:KW-0524	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Npas4	Rat	positive regulation of DNA-templated transcription	involved_in	ISO	Npas4 (Mus musculus)	1624291	PMID:18815592 and PMID:22194569	RGD	PMID:18815592 and PMID:22194569
Npas4	Rat	positive regulation of DNA-templated transcription	acts_upstream_of_or_within	IEA	UniProtKB:Q8BGD7 and ensembl:ENSMUSP00000062992	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Npas4	Rat	positive regulation of DNA-templated transcription	acts_upstream_of_or_within	ISO	Npas4 (Mus musculus)	1624291	PMID:15363889	RGD	PMID:15363889
Npas4	Rat	positive regulation of DNA-templated transcription	involved_in	ISS	UniProtKB:Q8BGD7	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Npas4	Rat	positive regulation of transcription by RNA polymerase II	involved_in	ISS	UniProtKB:Q8BGD7	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Npas4	Rat	positive regulation of transcription by RNA polymerase II	acts_upstream_of_or_within	IEA	UniProtKB:Q8BGD7 and ensembl:ENSMUSP00000062992	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Npas4	Rat	positive regulation of transcription by RNA polymerase II	acts_upstream_of_or_within	ISO	Npas4 (Mus musculus)	1624291	PMID:14701734	RGD	PMID:14701734
Npas4	Rat	positive regulation of transcription by RNA polymerase II	involved_in	ISO	Npas4 (Mus musculus)	1624291	PMID:18815592 more ...	RGD	PMID:18815592 more ...
Npas4	Rat	positive regulation of transcription by RNA polymerase II	involved_in	IEA	UniProtKB:Q8IUM7 and ensembl:ENSP00000311196	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Npas4	Rat	positive regulation of transcription by RNA polymerase II	involved_in	ISO	NPAS4 (Homo sapiens)	1624291	PMID:14701734 and PMID:24465693	RGD	PMID:14701734 and PMID:24465693
Npas4	Rat	regulation of synaptic plasticity	involved_in	ISO	Npas4 (Mus musculus)	1624291	PMID:18815592	RGD	PMID:18815592
Npas4	Rat	regulation of synaptic plasticity	involved_in	IEA	UniProtKB:Q8BGD7 and ensembl:ENSMUSP00000062992	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Npas4	Rat	regulation of synaptic plasticity	involved_in	ISS	UniProtKB:Q8BGD7	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Npas4	Rat	regulation of synaptic transmission, GABAergic	involved_in	ISS	UniProtKB:Q8BGD7	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Npas4	Rat	regulation of synaptic transmission, GABAergic	involved_in	IEA	UniProtKB:Q8BGD7 and ensembl:ENSMUSP00000062992	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Npas4	Rat	regulation of synaptic transmission, GABAergic	involved_in	ISO	Npas4 (Mus musculus)	1624291	PMID:18815592	RGD	PMID:18815592
Npas4	Rat	regulation of transcription by RNA polymerase II	involved_in	IBA	FB:FBgn0004666 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Npas4	Rat	short-term memory	involved_in	ISS	UniProtKB:Q8BGD7	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Npas4	Rat	short-term memory	involved_in	IEA	UniProtKB:Q8BGD7 and ensembl:ENSMUSP00000062992	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Npas4	Rat	short-term memory	involved_in	ISO	Npas4 (Mus musculus)	1624291	PMID:22194569	RGD	PMID:22194569
Npas4	Rat	social behavior	involved_in	ISS	UniProtKB:Q8BGD7	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Npas4	Rat	social behavior	involved_in	IEA	UniProtKB:Q8BGD7 and ensembl:ENSMUSP00000062992	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Npas4	Rat	social behavior	involved_in	ISO	Npas4 (Mus musculus)	1624291	PMID:23029555	RGD	PMID:23029555

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Npas4	Rat	cytosol	located_in	TAS		1600115	Reactome:R-RNO-9769759	Reactome	Reactome:R-RNO-9769759
Npas4	Rat	cytosol	located_in	TAS		1600115	Reactome:R-NUL-9769769	Reactome	Reactome:R-NUL-9769769
Npas4	Rat	nucleoplasm	located_in	TAS		1600115	Reactome:R-RNO-9769759	Reactome	Reactome:R-RNO-9769759
Npas4	Rat	nucleoplasm	located_in	TAS		1600115	Reactome:R-NUL-9769769	Reactome	Reactome:R-NUL-9769769
Npas4	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Npas4	Rat	nucleus	located_in	ISO	Npas4 (Mus musculus)	1624291	PMID:15363889 and PMID:24201284	RGD	PMID:15363889 and PMID:24201284
Npas4	Rat	nucleus	located_in	IEA	UniProtKB:Q8BGD7 and ensembl:ENSMUSP00000062992	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Npas4	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Npas4	Rat	postsynapse	located_in	IEA	GO:0060080	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Npas4	Rat	postsynapse	located_in	IEA	GO:0060079	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Npas4	Rat	transcription regulator complex	part_of	ISO	Npas4 (Mus musculus)	1624291	PMID:14701734	RGD	PMID:14701734
Npas4	Rat	transcription regulator complex	part_of	IEA	UniProtKB:Q8BGD7 and ensembl:ENSMUSP00000062992	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Npas4	Rat	DNA binding	enables	IEA	UniProtKB-KW:KW-0238	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Npas4	Rat	DNA-binding transcription activator activity, RNA polymerase II-specific	enables	ISO	NPAS4 (Homo sapiens)	1624291	PMID:14701734	RGD	PMID:14701734
Npas4	Rat	DNA-binding transcription activator activity, RNA polymerase II-specific	enables	IEA	UniProtKB:Q8IUM7 and ensembl:ENSP00000311196	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Npas4	Rat	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	ISS	UniProtKB:Q8BGD7	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Npas4	Rat	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	IEA	UniProtKB:Q8IUM7 and ensembl:ENSP00000311196	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Npas4	Rat	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	IEA	UniProtKB:Q8BGD7 and ensembl:ENSMUSP00000062992	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Npas4	Rat	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	IBA	FB:FBgn0004666 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Npas4	Rat	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	ISO	Npas4 (Mus musculus)	1624291	PMID:18815592 more ...	RGD	PMID:18815592 more ...
Npas4	Rat	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	ISO	NPAS4 (Homo sapiens)	1624291	PMID:24465693	RGD	PMID:24465693
Npas4	Rat	protein binding	enables	ISO	NPAS4 (Homo sapiens)	1624291	UniProtKB:Q9HBZ2 and PMID:24465693	RGD	PMID:24465693
Npas4	Rat	protein binding	enables	ISO	Npas4 (Mus musculus)	1624291	PR:Q61324 more ...	RGD	PMID:14701734 and PMID:27782878
Npas4	Rat	protein dimerization activity	enables	IEA	InterPro:IPR011598	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Npas4	Rat	protein heterodimerization activity	enables	ISO	NPAS4 (Homo sapiens)	1624291	PMID:24465693	RGD	PMID:24465693
Npas4	Rat	protein heterodimerization activity	enables	IEA	UniProtKB:Q8BGD7 and ensembl:ENSMUSP00000062992	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Npas4	Rat	protein heterodimerization activity	enables	IEA	UniProtKB:Q8IUM7 and ensembl:ENSP00000311196	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Npas4	Rat	protein heterodimerization activity	enables	ISO	Npas4 (Mus musculus)	1624291	PMID:27782878	RGD	PMID:27782878
Npas4	Rat	protein-containing complex binding		IDA		1304280	heterodimerization	RGD
Npas4	Rat	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	ISS	UniProtKB:Q8BGD7	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Npas4	Rat	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	IEA	UniProtKB:Q8IUM7 and ensembl:ENSP00000311196	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Npas4	Rat	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	IEA	UniProtKB:Q8BGD7 and ensembl:ENSMUSP00000062992	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Npas4	Rat	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	ISO	Npas4 (Mus musculus)	1624291	PMID:14701734 and PMID:22194569	RGD	PMID:14701734 and PMID:22194569
Npas4	Rat	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	ISO	NPAS4 (Homo sapiens)	1624291	PMID:14701734	RGD	PMID:14701734
Npas4	Rat	RNA polymerase II transcription regulatory region sequence-specific DNA binding	enables	IEA	UniProtKB:Q8BGD7 and ensembl:ENSMUSP00000062992	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Npas4	Rat	RNA polymerase II transcription regulatory region sequence-specific DNA binding	enables	ISO	Npas4 (Mus musculus)	1624291	PMID:24201284	RGD	PMID:24201284
Npas4	Rat	RNA polymerase II transcription regulatory region sequence-specific DNA binding	enables	IBA	FB:FBgn0004666 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Identification of a novel basic helix-loop-helix-PAS factor, NXF, reveals a Sim2 competitive, positive regulatory role in dendritic-cytoskeleton modulator drebrin gene expression.	Ooe N, etal., Mol Cell Biol 2004 Jan;24(2):608-16.
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Information Derived from GenBank Report	RGD, Sept. 2003

PMID:15363889	PMID:18815592	PMID:19001414	PMID:19083991	PMID:20626564	PMID:21887312	PMID:22194569	PMID:22674715	PMID:23029555	PMID:23431968	PMID:23861074	PMID:24201284
PMID:24465693	PMID:24855953	PMID:25536221	PMID:26635026	PMID:27782878	PMID:28957664	PMID:29196218	PMID:29899116	PMID:31041873	PMID:31883511

Npas4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	211,710,640 - 211,728,038 (-)	NCBI		GRCr8
mRatBN7.2	1	202,281,260 - 202,298,681 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	202,281,958 - 202,286,724 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	210,634,984 - 210,639,756 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	217,727,377 - 217,732,147 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	210,418,406 - 210,423,176 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	220,260,310 - 220,278,177 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	220,261,008 - 220,265,772 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	227,191,333 - 227,209,087 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	207,597,735 - 207,602,499 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	207,751,187 - 207,755,952 (-)	NCBI
Celera	1	199,821,938 - 199,826,702 (-)	NCBI		Celera
Cytogenetic Map	1	q43	NCBI

NPAS4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	66,409,158 - 66,426,707 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	66,421,035 - 66,426,707 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	66,188,475 - 66,194,178 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	65,945,051 - 65,950,753 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	65,945,050 - 65,950,753	NCBI
Celera	11	63,508,508 - 63,514,210 (+)	NCBI		Celera
Cytogenetic Map	11	q13.2	NCBI
HuRef	11	62,516,143 - 62,521,845 (+)	NCBI		HuRef
CHM1_1	11	66,072,529 - 66,078,231 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	66,405,041 - 66,423,054 (+)	NCBI		T2T-CHM13v2.0

Npas4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	5,034,381 - 5,053,467 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	5,034,383 - 5,040,344 (-)	Ensembl		GRCm39 Ensembl
GRCm38	19	4,984,353 - 5,003,439 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	4,984,355 - 4,990,316 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	19	4,984,355 - 4,989,971 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	19	4,984,355 - 4,989,971 (-)	NCBI		MGSCv36	mm8
Celera	19	4,853,421 - 4,859,037 (-)	NCBI		Celera
Cytogenetic Map	19	A	NCBI
cM Map	19	4.2	NCBI

Npas4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955422	18,907,322 - 18,913,428 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955422	18,907,328 - 18,913,088 (-)	NCBI	ChiLan1.0	ChiLan1.0

NPAS4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	67,646,711 - 67,652,386 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	68,689,424 - 68,695,098 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	61,778,329 - 61,784,010 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	65,103,096 - 65,108,825 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	65,103,097 - 65,108,825 (+)	Ensembl	panpan1.1		panPan2

NPAS4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	50,905,614 - 50,912,119 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	50,905,611 - 50,911,086 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	49,514,917 - 49,520,038 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	51,944,546 - 51,949,657 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	51,943,941 - 51,949,559 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	51,045,124 - 51,050,230 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	50,618,773 - 50,623,881 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	51,408,871 - 51,413,979 (-)	NCBI		UU_Cfam_GSD_1.0

Npas4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	6,702,444 - 6,718,932 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936599	3,144,793 - 3,150,377 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936599	3,144,829 - 3,150,307 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NPAS4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	5,990,327 - 5,995,929 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	5,990,936 - 5,995,940 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	5,066,741 - 5,072,489 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NPAS4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	7,856,222 - 7,874,812 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	7,856,939 - 7,862,052 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	105,136,036 - 105,154,282 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Npas4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624767	19,954,323 - 19,959,360 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624767	19,953,746 - 19,959,472 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Npas4
32 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	105
Count of miRNA genes:	91
Interacting mature miRNAs:	95
Transcripts:	ENSRNOT00000027119
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1357335	Bw39	Body weight QTL 39	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	1	197814409	242814409	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
2302375	Bw83	Body weight QTL 83	4.87	0.0002	body mass (VT:0001259)	body weight (CMO:0000012)	1	197697768	242697768	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	177227632	256448636	Rat
2293674	Bss39	Bone structure and strength QTL 39	7.1	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	1	201554356	246554356	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
1354653	Despr9	Despair related QTL 9		0.00019	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	167909849	212909849	Rat
2293673	Bss27	Bone structure and strength QTL 27	18.63	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	1	171629477	216629477	Rat
2293677	Bss41	Bone structure and strength QTL 41	9.38	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	1	171629477	216629477	Rat
1302787	Stl25	Serum triglyceride level QTL 25	2.7	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	180359209	210702199	Rat
1549830	Bss1	Bone structure and strength QTL 1	4.8		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	172609619	217609619	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
70163	Bw20	Body weight QTL 20	5.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	174133260	219133260	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	195804352	257091168	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	177227632	256448636	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
1558658	Bw59	Body weight QTL 59	3.5	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	1	178784622	223784622	Rat
631838	Niddm36	Non-insulin dependent diabetes mellitus QTL 36		0.01	insulin secretion trait (VT:0003564)	calculated pancreatic islet insulin release measurement (CMO:0001217)	1	184550676	229550676	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
2293689	Bss47	Bone structure and strength QTL 47	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	1	171629477	216629477	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	123556856	242907031	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
2293694	Bss38	Bone structure and strength QTL 38	7.05	0.0001	femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	1	201554356	246554356	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	143506580	212458660	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	169537671	214537671	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
2293693	Bss22	Bone structure and strength QTL 22	33.52	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	1	171629477	216629477	Rat
2300161	Bmd43	Bone mineral density QTL 43	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
1300145	Rf7	Renal function QTL 7	2.96		urine creatinine amount (VT:0010540)	urine creatinine level (CMO:0000125)	1	185145134	221264292	Rat
61347	Bp197	Blood pressure QTL 197	4.2		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	1	158633083	203633083	Rat
8655655	Arrd2	Age-related retinal degeneration QTL 2	7.79		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	183970203	243914901	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	191019702	246062233	Rat
631214	Bw61	Body weight QTL61	3.4	0.0001	intramuscular adipose amount (VT:0010044)	intramuscular fat area (CMO:0001162)	1	173108781	218108781	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	149448574	221264292	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642644	214537671	Rat
2300175	Bmd40	Bone mineral density QTL 40	15.4	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	1	201554356	246554356	Rat
2300174	Bmd42	Bone mineral density QTL 42	8.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	1	171629477	216629477	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	144267353	222987745	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	151162766	225824951	Rat
737977	Bp160	Blood pressure QTL 160		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	181133855	226133855	Rat
2293654	Bss30	Bone structure and strength QTL 30	32.65	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	1	171629477	216629477	Rat
2293655	Bss36	Bone structure and strength QTL 36	10.66	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	201554356	246554356	Rat
1298084	Thym4	Thymus enlargement QTL 4	10.68		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	197814409	242814409	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
2300187	Bmd41	Bone mineral density QTL 41	8.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
8552891	Epfw5	Epididymal fat weight QTL 5	4.4		epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	1	193113876	238113876	Rat
1359018	Hrtrt20	Heart rate QTL 20	3.08		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	185356336	202902618	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
1358292	Cm37	Cardiac mass QTL 37	6.2	8e-07	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	1	196248093	241248093	Rat
61376	Bp42	Blood pressure QTL 42	23.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	197814409	242814409	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	199050459	259647894	Rat
634312	Bp143	Blood pressure QTL 143	3	0.0002	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	182623426	219932796	Rat
1358294	Bw37	Body weight QTL 37	5	0.000011	body mass (VT:0001259)	body weight (CMO:0000012)	1	171310381	216310381	Rat
724559	Pancm1	Pancreatic morphology QTL 1	7.1		islet of Langerhans morphology trait (VT:0005215)	pancreatic islet damage composite score (CMO:0001156)	1	181759564	214537555	Rat
2312420	Pur17	Proteinuria QTL 17	7.1	0.0001	urine protein amount (VT:0005160)	urine total protein excretion rate (CMO:0000756)	1	156677124	218753816	Rat
10059600	Bp378	Blood pressure QTL 378	3.08	0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	176869060	221869060	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
619613	Bp77	Blood pressure QTL 77		0.01	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	164747424	209747424	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	185356336	231689108	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	178810256	240830002	Rat
2292218	Kidm35	Kidney mass QTL 35			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	199368955	224569684	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	169537671	214537671	Rat
1331790	Bp201	Blood pressure QTL 201	3.127		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	198211513	225126682	Rat
10059587	Bw173	Body weight QTL 173	3.23	0.025	body mass (VT:0001259)	body weight (CMO:0000012)	1	202069611	247069611	Rat
2292222	Bp307	Blood pressure QTL 307	3.06	0.0014	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	213533942	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	243914901	Rat
10059590	Kidm44	Kidney mass QTL 44	3.42	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	191033875	236033875	Rat
1641926	Teswt2	Testicular weight QTL 2	2.82		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	1	197697768	238755659	Rat
631658	Cm7	Cardiac mass QTL 7	5.32	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	1	196248093	241248093	Rat
1600380	Niddm70	Non-insulin dependent diabetes mellitus QTL 70	3.1	0.0008	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	176550523	221550523	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1582206	Kidm33	Kidney mass QTL 33	6.9		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	188377360	224054420	Rat
8655855	Arrd3	Age-related retinal degeneration QTL 3	3.07		lens clarity trait (VT:0001304)	cataract incidence/prevalence measurement (CMO:0001585)	1	183970203	243914901	Rat
634338	Hcar4	Hepatocarcinoma resistance QTL 4	4.6		liver integrity trait (VT:0010547)	liver tumorous lesion number to liver area ratio (CMO:0001210)	1	193422268	214537671	Rat
6903303	Scl34	Serum cholesterol QTL 34	2.5	0.0033	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	180359209	218108781	Rat
1600374	Mcs17	Mammary carcinoma susceptibility QTL 17	3		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	197670404	242670404	Rat
2293083	Iddm25	Insulin dependent diabetes mellitus QTL 25	4.18		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	181829673	224569684	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	176426412	257976495	Rat
1358191	Ept10	Estrogen-induced pituitary tumorigenesis QTL 10	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	192825253	243914732	Rat
7394701	Uae46	Urinary albumin excretion QTL 46	3.6	0.0056	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	201554356	246554356	Rat

MARC_12329-12330:1005768102:1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	202,283,344 - 202,283,783 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	220,262,393 - 220,262,831	NCBI	Rnor6.0
Rnor_5.0	1	227,193,416 - 227,193,854	UniSTS	Rnor5.0
RGSC_v3.4	1	207,599,120 - 207,599,558	UniSTS	RGSC3.4
Celera	1	199,823,323 - 199,823,761	UniSTS
Cytogenetic Map	1	q43	UniSTS

Npas4

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	202,283,031 - 202,283,625 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	220,262,080 - 220,262,673	NCBI	Rnor6.0
Rnor_5.0	1	227,193,103 - 227,193,696	UniSTS	Rnor5.0
Celera	1	199,823,010 - 199,823,603	UniSTS
Cytogenetic Map	1	q43	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	34	97	35	38	18	13	18	6	110	58	85	25	56	20


RefSeq Transcripts	NM_153626	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102501	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB050103	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000027119 ⟹ ENSRNOP00000027119

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	202,281,958 - 202,286,724 (-)	Ensembl
Rnor_6.0 Ensembl	1	220,261,008 - 220,265,772 (-)	Ensembl

RefSeq Acc Id:

NM_153626 ⟹ NP_705890

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	211,711,338 - 211,716,102 (-)	NCBI
mRatBN7.2	1	202,281,958 - 202,286,724 (-)	NCBI
Rnor_6.0	1	220,261,008 - 220,265,772 (-)	NCBI
Rnor_5.0	1	227,191,333 - 227,209,087 (-)	NCBI
RGSC_v3.4	1	207,597,735 - 207,602,499 (-)	RGD
Celera	1	199,821,938 - 199,826,702 (-)	RGD

Sequence:

show sequence

GGGAGCCGGAGCTGGAGCTCCACGGCCGGCAGTCATGTACCGATCCACCAAGGGCGCCTCCAAGGCGCGCCGCGACCAGATCAACGCCGAGATTCGGAACCTCAAGGAACTGCTGCCGTTGGCTGAAG
CGGACAAGGTCCGGCTGTCCTACCTGCACATCATGAGTCTTGCCTGCATCTACACTCGCAAGGGTGTCTTCTTTGCTGGAGGCACTCCTTTGGCTGGCCCCACGGGGCTTCTCTCTGCTCAAGAGCTT
GAAGACATAGTGGCAGCACTACCTGGATTTCTACTTGTGTTCACAGCTGAGGGGAAGTTGCTATACCTGTCGGAGAGTGTGAGCGAGCATCTGGGCCATTCTATGGTGGATCTGGTTGCCCAGGGTGA
CAGTATTTACGACATCATTGACCCTGCTGACCATCTCACTGTGCGCCAGCAGCTCACCATGCCCTCTGCTCTGGATGCTGATCGCCTTTTCCGTTGTCGATTTAACACATCCAAGTCCCTCCGGCGCC
AGAGTGCAGGCAACAAACTGGTGCTTATTCGAGGTCGATTCCATGCTCACCCACCTGGGGCCTACTGGGCAGGAAACCCCGTGTTCACAGCTTTCTGTGCCCCACTGGAGCCAAGACCCCGTCCCGGC
CCTGGCCCTGGCCCTGGCCCTGGTCCTGCCTCTCTCTTCCTGGCCATGTTCCAGAGCCGGCATGCTAAGGACCTAGCCCTACTGGACATTTCTGAAAGTGTCCTAATCTACCTGGGCTTTGAGCGCAG
CGAACTGCTCTGTAAATCATGGTATGGACTGCTACACCCCGAGGACCTGGCCCACGCTTCTTCTCAACACTACCGCCTGTTGGCTGAAAATGGAGATATTCAGGCTGAAATGGTGGTGAGACTTCAAG
CCAAGCATGGAGGCTGGACATGGATTTACTGCATGCTATACTCGGATGGTCCAGAAGGCCCTATTACTGCCAATAACTACCCTATCAGTGACACGGAAGCCTGGAGTCTTCGCCAGCAGCTAAACTCT
GAAAACACCCAGGCAGCCTATGTCCTAGGAACCCCAGCTGTGCTACCCTCATTCTCTGAGAATGTCTTCTCCCAGGAGCACTGCTCTAATCCACTCTTTACACCAGCCCTGGGGACTCCTAGAAGTGC
CAGCTTCCCCAGGGCCCCTGAACTAGGTGTGATCTCAACATCAGAAGAGCTTGCCCAACCCTCCAAAGAACTGGACTTCAGTTACCTGCCATTCCCTGCAAGGCCTGAGCCTTCCCTCCAAGCAGACT
TGAGCAAGGATTTGGTGTGTACTCCACCTTACACACCCCACCAGCCAGGAGGCTGCGCCTTCCTCTTCAGCCTCCATGAACCCTTCCAGACTCACTTGCCCCCTCCATCCAGCTCTCTCCAAGAACAG
CTGACGCCAAGCACGGTGACTTTCTCTGAACAGTTGACACCAAGCAGTGCAACCTTCCCAGATCCACTAACCAGTTCACTACAAGGACAGTTGACTGAAAGCTCAGCCAGAAGCTTTGAAGAACAATT
GACTCCGTGCACCTCTACCTTCCCTGACCAGCTGCTTCCCAGCACTGCCACGTTCCCAGAACCTCTGGGTAGCCCCACCCATGAGCAGCTGACTCCTCCCAGCACAGCATTCCAAGCACATCTGAACA
GTCCTAGCCAAACCTTCCCAGAGCAACTGAGCCCTAATCCTACCAAGACTTACTTCGCCCAGGAGGGATGCAGTTTTCTCTATGAGAAGTTGCCCCCAAGTCCTAGCAGCCCTGGTAATGGGGACTGT
ACACTCTTGGCCCTAGCTCAACTCCGGGGTCCCCTCTCTGTGGACGTCCCCCTGGTGCCTGAAGGCCTGCTCACACCTGAGGCCTCTCCAGTCAAGCAAAGTTTCTTCCACTATACAGAGAAAGAGCA
GAATGAGATAGATCGTCTCATCCAGCAGATCAGCCAGTTGGCTCAGGGCATGGACAGGCCCTTCTCAGCTGAGGCTGGCACTGGGGGGCTGGAGCCACTTGGAGGGCTGGAGCCCCTGAACCCCAACC
TGTCCCTGTCAGGGGCTGGACCCCCTGTGCTTAGCCTGGATCTTAAACCCTGGAAATGCCAGGAGCTGGACTTCTTGGTTGACCCTGATAATTTATTCCTGGAAGAGACGCCAGTGGAAGACATCTTC
ATGGATCTTTCTACTCCAGACCCCAATGGGGAATGGGGTTCAGGGGATCCTGAGGCAGAGGTCCCAGGAGGGACCCTGTCACCTTGCAACAACCTGTCCCCAGAAGATCACAGCTTCCTGGAGGACTT
GGCCACCTATGAAACCGCCTTTGAGACAGGTGTCTCAACATTCCCCTATGAAGGGTTTGCTGATGAGTTGCATCAACTCCAGAGCCAAGTTCAAGACAGCTTCCATGAAGATGGAAGTGGAGGGGAAC
CAACGTTTTGAATAAGTCTGTGACTTAA

hide sequence

RefSeq Acc Id:

XM_039102501 ⟹ XP_038958429

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	211,710,640 - 211,728,038 (-)	NCBI
mRatBN7.2	1	202,281,260 - 202,298,681 (-)	NCBI


Protein RefSeqs	NP_705890	(Get FASTA)	NCBI Sequence Viewer
	XP_038958429	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAC19832	(Get FASTA)	NCBI Sequence Viewer
	EDM12442	(Get FASTA)	NCBI Sequence Viewer
	EDM12443	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000027119
	ENSRNOP00000027119.2
GenBank Protein	Q8CJH6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_705890 ⟸ NM_153626

- UniProtKB:

Q8CJH6 (UniProtKB/Swiss-Prot), A6HZ11 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MYRSTKGASKARRDQINAEIRNLKELLPLAEADKVRLSYLHIMSLACIYTRKGVFFAGGTPLAGPTGLLSAQELEDIVAALPGFLLVFTAEGKLLYLSESVSEHLGHSMVDLVAQGDSIYDIIDPADH
LTVRQQLTMPSALDADRLFRCRFNTSKSLRRQSAGNKLVLIRGRFHAHPPGAYWAGNPVFTAFCAPLEPRPRPGPGPGPGPGPASLFLAMFQSRHAKDLALLDISESVLIYLGFERSELLCKSWYGLL
HPEDLAHASSQHYRLLAENGDIQAEMVVRLQAKHGGWTWIYCMLYSDGPEGPITANNYPISDTEAWSLRQQLNSENTQAAYVLGTPAVLPSFSENVFSQEHCSNPLFTPALGTPRSASFPRAPELGVI
STSEELAQPSKELDFSYLPFPARPEPSLQADLSKDLVCTPPYTPHQPGGCAFLFSLHEPFQTHLPPPSSSLQEQLTPSTVTFSEQLTPSSATFPDPLTSSLQGQLTESSARSFEEQLTPCTSTFPDQL
LPSTATFPEPLGSPTHEQLTPPSTAFQAHLNSPSQTFPEQLSPNPTKTYFAQEGCSFLYEKLPPSPSSPGNGDCTLLALAQLRGPLSVDVPLVPEGLLTPEASPVKQSFFHYTEKEQNEIDRLIQQIS
QLAQGMDRPFSAEAGTGGLEPLGGLEPLNPNLSLSGAGPPVLSLDLKPWKCQELDFLVDPDNLFLEETPVEDIFMDLSTPDPNGEWGSGDPEAEVPGGTLSPCNNLSPEDHSFLEDLATYETAFETGV
STFPYEGFADELHQLQSQVQDSFHEDGSGGEPTF

hide sequence

Ensembl Acc Id:

ENSRNOP00000027119 ⟸ ENSRNOT00000027119

RefSeq Acc Id:	XP_038958429 ⟸ XM_039102501
- Peptide Label:	isoform X1
- UniProtKB:	Q8CJH6 (UniProtKB/Swiss-Prot), A6HZ11 (UniProtKB/TrEMBL)

Protein Domains

bHLH PAC PAS

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8CJH6-F1-model_v2	AlphaFold	Q8CJH6	1-802	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-56721	BioCyc
Ensembl Genes	ENSRNOG00000020009	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000027119	ENTREZGENE
	ENSRNOT00000027119.3	UniProtKB/Swiss-Prot
Gene3D-CATH	PAS domain	UniProtKB/Swiss-Prot
InterPro	bHLH_dom	UniProtKB/Swiss-Prot
	PAS	UniProtKB/Swiss-Prot
	PAS-like_dom_sf	UniProtKB/Swiss-Prot
	PAS_fold_3	UniProtKB/Swiss-Prot
KEGG Report	rno:266734	UniProtKB/Swiss-Prot
NCBI Gene	266734	ENTREZGENE
PANTHER	HYPOXIA-INDUCIBLE FACTOR 1 ALPHA	UniProtKB/Swiss-Prot
	NEURONAL PAS DOMAIN-CONTAINING PROTEIN 4	UniProtKB/Swiss-Prot
Pfam	PAS_3	UniProtKB/Swiss-Prot
PhenoGen	Npas4	PhenoGen
PROSITE	BHLH	UniProtKB/Swiss-Prot
	PAS	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000020009	RatGTEx
SMART	PAS	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF55785	UniProtKB/Swiss-Prot
UniProt	A6HZ11	ENTREZGENE, UniProtKB/TrEMBL
	A6HZ12_RAT	UniProtKB/TrEMBL
	NPAS4_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Npas4	neuronal PAS domain protein 4	Nxf	bHLH-PAS type transcription factor NXF	Symbol and Name updated	1299863	APPROVED
2005-01-20	Nxf	bHLH-PAS type transcription factor NXF		bHLH PAS type transcription factor NXF	Name updated	1299863	APPROVED
2003-02-27	Nxf	bHLH PAS type transcription factor NXF			Symbol and Name status set to provisional	70820	PROVISIONAL

Note Type	Note	Reference
gene_domains	contains basic helix-loop-helix and PAS domains	634611

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar