Symbol:
Cst6
Name:
cystatin E/M
RGD ID:
628799
Description:
Predicted to enable cysteine-type endopeptidase inhibitor activity. Predicted to act upstream of or within epidermis development. Predicted to be located in cornified envelope. Human ortholog(s) of this gene implicated in ectodermal dysplasia 15. Orthologous to human CST6 (cystatin E/M); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
cystatin M; cystatin N; cystatin-M
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CST6 (cystatin E/M) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB
Mus musculus (house mouse):
Cst6 (cystatin E/M) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cst6 (cystatin E/M) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CST6 (cystatin E/M) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CST6 (cystatin E/M) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cst6 (cystatin E/M) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CST6 (cystatin E/M) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CST6 (cystatin E/M) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cst6 (cystatin E/M) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Cst6 (cystatin E/M)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
CST6 (cystatin E/M)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
cpi-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 212,084,676 - 212,086,384 (-) NCBI GRCr8 mRatBN7.2 1 202,655,322 - 202,657,030 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 202,655,322 - 202,657,030 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 211,008,165 - 211,009,874 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 218,100,747 - 218,102,455 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 210,791,794 - 210,793,502 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 220,727,292 - 220,729,000 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 220,727,292 - 220,729,000 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 227,656,559 - 227,658,267 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 207,991,313 - 207,993,021 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 208,144,765 - 208,146,474 (-) NCBI Celera 1 200,190,620 - 200,192,328 (-) NCBI Celera Cytogenetic Map 1 q43 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cst6 Rat 17alpha-ethynylestradiol multiple interactions ISO Cst6 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CST6 mRNA CTD PMID:17942748 Cst6 Rat 17beta-estradiol decreases expression ISO CST6 (Homo sapiens) 6480464 Estradiol results in decreased expression of CST6 mRNA CTD PMID:25321415 Cst6 Rat 17beta-estradiol multiple interactions ISO CST6 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of CST6 mRNA CTD PMID:30165855 Cst6 Rat 17beta-estradiol affects expression ISO CST6 (Homo sapiens) 6480464 Estradiol affects the expression of CST6 mRNA CTD PMID:22574217 Cst6 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Cst6 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Cst6 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Cst6 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Cst6 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Cst6 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CST6 mRNA CTD PMID:17942748 Cst6 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CST6 mRNA CTD PMID:33387578 Cst6 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CST6 mRNA CTD PMID:34747641 Cst6 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO CST6 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of CST6 mRNA CTD PMID:23152189 Cst6 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cst6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CST6 mRNA CTD PMID:21570461 Cst6 Rat 2,4-D multiple interactions ISO Cst6 (Mus musculus) 6480464 [lard co-treated with Cholesterol more ... CTD PMID:37567420 Cst6 Rat 2-hydroxypropanoic acid decreases expression ISO CST6 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of CST6 mRNA CTD PMID:30851411 Cst6 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of CST6 protein CTD PMID:34915118 Cst6 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO CST6 (Homo sapiens) 6480464 [Dexamethasone co-treated with 8-Bromo Cyclic Adenosine Monophosphate co-treated with 1-Methyl-3-isobutylxanthine] results in decreased expression of CST6 mRNA CTD PMID:16997883 Cst6 Rat 5-aza-2'-deoxycytidine increases expression ISO CST6 (Homo sapiens) 6480464 Decitabine results in increased expression of CST6 mRNA CTD PMID:21856257 Cst6 Rat 5-aza-2'-deoxycytidine affects expression ISO CST6 (Homo sapiens) 6480464 Decitabine affects the expression of CST6 mRNA CTD PMID:17043665 Cst6 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of CST6 mRNA CTD PMID:24780913 Cst6 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of CST6 mRNA CTD PMID:25825206 and PMID:30047161 Cst6 Rat 8-Br-cAMP multiple interactions ISO CST6 (Homo sapiens) 6480464 [Dexamethasone co-treated with 8-Bromo Cyclic Adenosine Monophosphate co-treated with 1-Methyl-3-isobutylxanthine] results in decreased expression of CST6 mRNA CTD PMID:16997883 Cst6 Rat aflatoxin B1 increases expression ISO CST6 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of CST6 mRNA CTD PMID:22100608 Cst6 Rat aldehydo-D-glucose multiple interactions ISO Cst6 (Mus musculus) 6480464 [lard co-treated with Cholesterol more ... CTD PMID:37567420 Cst6 Rat all-trans-retinoic acid increases expression ISO CST6 (Homo sapiens) 6480464 Tretinoin results in increased expression of CST6 mRNA CTD PMID:16249480 and PMID:23830798 Cst6 Rat amiodarone increases expression ISO CST6 (Homo sapiens) 6480464 Amiodarone results in increased expression of CST6 mRNA CTD PMID:19774075 Cst6 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of CST6 mRNA CTD PMID:30047161 Cst6 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CST6 mRNA CTD PMID:16483693 Cst6 Rat arsane multiple interactions ISO CST6 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of CST6 mRNA CTD PMID:32525701 Cst6 Rat arsenic atom multiple interactions ISO CST6 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of CST6 mRNA CTD PMID:32525701 Cst6 Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of CST6 mRNA CTD PMID:21839799 Cst6 Rat benzo[a]pyrene affects methylation ISO CST6 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of CST6 exon and Benzo(a)pyrene affects the methylation of CST6 promoter CTD PMID:27901495 Cst6 Rat benzo[a]pyrene decreases methylation ISO Cst6 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of CST6 promoter CTD PMID:27901495 Cst6 Rat benzo[a]pyrene decreases methylation ISO CST6 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of CST6 3' UTR CTD PMID:27901495 Cst6 Rat benzo[a]pyrene decreases expression ISO CST6 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of CST6 mRNA CTD PMID:22316170 Cst6 Rat bis(2-chloroethyl) sulfide increases expression ISO CST6 (Homo sapiens) 6480464 Mustard Gas results in increased expression of CST6 mRNA CTD PMID:25102026 Cst6 Rat bis(2-ethylhexyl) phthalate increases expression ISO CST6 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of CST6 mRNA CTD PMID:31163220 Cst6 Rat bis(2-ethylhexyl) phthalate increases expression ISO Cst6 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of CST6 mRNA CTD PMID:34319233 Cst6 Rat bisphenol A decreases expression ISO CST6 (Homo sapiens) 6480464 bisphenol A results in decreased expression of CST6 mRNA CTD PMID:26363213 Cst6 Rat bisphenol A decreases expression ISO Cst6 (Mus musculus) 6480464 bisphenol A results in decreased expression of CST6 mRNA CTD PMID:35598803 Cst6 Rat bisphenol A increases expression ISO Cst6 (Mus musculus) 6480464 bisphenol A results in increased expression of CST6 mRNA CTD PMID:32156529 and PMID:35479511 Cst6 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CST6 mRNA CTD PMID:30816183 Cst6 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CST6 mRNA CTD PMID:25181051 Cst6 Rat butan-1-ol multiple interactions ISO CST6 (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of CST6 mRNA CTD PMID:29432896 Cst6 Rat cadmium atom increases expression ISO CST6 (Homo sapiens) 6480464 Cadmium results in increased expression of CST6 mRNA CTD PMID:21120746 Cst6 Rat cadmium dichloride affects expression EXP 6480464 Cadmium Chloride affects the expression of CST6 mRNA CTD PMID:22110744 Cst6 Rat cadmium dichloride increases expression ISO CST6 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of CST6 mRNA CTD PMID:38568856 Cst6 Rat cadmium dichloride decreases expression ISO CST6 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of CST6 mRNA CTD PMID:26472689 and PMID:38382870 Cst6 Rat calcitriol increases expression ISO CST6 (Homo sapiens) 6480464 Calcitriol results in increased expression of CST6 mRNA CTD PMID:12040012 and PMID:16002434 Cst6 Rat carbamazepine affects expression ISO CST6 (Homo sapiens) 6480464 Carbamazepine affects the expression of CST6 mRNA CTD PMID:25979313 Cst6 Rat cobalt atom multiple interactions ISO CST6 (Homo sapiens) 6480464 [tungsten carbide binds to Cobalt] which results in increased expression of CST6 mRNA CTD PMID:20105288 Cst6 Rat cobalt dichloride increases expression ISO CST6 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of CST6 mRNA CTD PMID:20105288 Cst6 Rat copper atom multiple interactions ISO Cst6 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression of CST6 mRNA CTD PMID:15467011 Cst6 Rat copper atom multiple interactions ISO CST6 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of CST6 mRNA CTD PMID:24690739 Cst6 Rat copper(0) multiple interactions ISO Cst6 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression of CST6 mRNA CTD PMID:15467011 Cst6 Rat copper(0) multiple interactions ISO CST6 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of CST6 mRNA CTD PMID:24690739 Cst6 Rat corosolic acid increases expression ISO CST6 (Homo sapiens) 6480464 corosolic acid results in increased expression of CST6 mRNA CTD PMID:37939859 Cst6 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of CST6 mRNA CTD PMID:26577399 Cst6 Rat cyclosporin A decreases expression ISO CST6 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of CST6 mRNA CTD PMID:27989131 Cst6 Rat D-glucose multiple interactions ISO Cst6 (Mus musculus) 6480464 [lard co-treated with Cholesterol more ... CTD PMID:37567420 Cst6 Rat dexamethasone multiple interactions ISO CST6 (Homo sapiens) 6480464 [Dexamethasone co-treated with 8-Bromo Cyclic Adenosine Monophosphate co-treated with 1-Methyl-3-isobutylxanthine] results in decreased expression of CST6 mRNA CTD PMID:16997883 Cst6 Rat disulfiram multiple interactions ISO CST6 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of CST6 mRNA CTD PMID:24690739 Cst6 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of CST6 mRNA CTD PMID:21551480 Cst6 Rat dorsomorphin multiple interactions ISO CST6 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Cst6 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of CST6 mRNA CTD PMID:29391264 Cst6 Rat entinostat multiple interactions ISO CST6 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CST6 mRNA CTD PMID:27188386 Cst6 Rat entinostat increases expression ISO CST6 (Homo sapiens) 6480464 entinostat results in increased expression of CST6 mRNA CTD PMID:26272509 Cst6 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of CST6 mRNA CTD PMID:30307764 Cst6 Rat fructose multiple interactions ISO Cst6 (Mus musculus) 6480464 [lard co-treated with Cholesterol more ... CTD PMID:37567420 Cst6 Rat furan increases expression EXP 6480464 furan results in increased expression of CST6 mRNA CTD PMID:25539665 and PMID:27387713 Cst6 Rat glucose multiple interactions ISO Cst6 (Mus musculus) 6480464 [lard co-treated with Cholesterol more ... CTD PMID:37567420 Cst6 Rat graphite affects expression EXP 6480464 Graphite affects the expression of CST6 mRNA CTD PMID:29933104 Cst6 Rat hydroquinone increases expression ISO CST6 (Homo sapiens) 6480464 hydroquinone results in increased expression of CST6 mRNA CTD PMID:31256213 Cst6 Rat L-ascorbic acid increases expression EXP 6480464 Ascorbic Acid results in increased expression of CST6 mRNA CTD PMID:15372504 Cst6 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of CST6 mRNA CTD PMID:30047161 Cst6 Rat methotrexate affects response to substance ISO CST6 (Homo sapiens) 6480464 CST6 protein affects the susceptibility to Methotrexate CTD PMID:16217747 Cst6 Rat methotrexate increases expression ISO CST6 (Homo sapiens) 6480464 Methotrexate results in increased expression of CST6 mRNA CTD PMID:21678067 Cst6 Rat N-methyl-4-phenylpyridinium increases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in increased expression of CST6 mRNA CTD PMID:28801915 Cst6 Rat N-nitrosodiethylamine increases expression ISO CST6 (Homo sapiens) 6480464 Diethylnitrosamine results in increased expression of CST6 mRNA CTD PMID:21527772 Cst6 Rat PCB138 multiple interactions ISO Cst6 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Cst6 Rat phenylmercury acetate multiple interactions ISO CST6 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CST6 mRNA CTD PMID:27188386 Cst6 Rat pirinixic acid multiple interactions ISO Cst6 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of CST6 mRNA CTD PMID:19710929 Cst6 Rat pirinixic acid increases expression ISO Cst6 (Mus musculus) 6480464 pirinixic acid results in increased expression of CST6 mRNA CTD PMID:17426115 Cst6 Rat potassium dichromate increases expression ISO CST6 (Homo sapiens) 6480464 Potassium Dichromate results in increased expression of CST6 mRNA CTD PMID:11678601 Cst6 Rat potassium dichromate increases expression ISO Cst6 (Mus musculus) 6480464 Potassium Dichromate results in increased expression of CST6 mRNA CTD PMID:23608068 Cst6 Rat rac-lactic acid decreases expression ISO CST6 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of CST6 mRNA CTD PMID:30851411 Cst6 Rat SB 431542 multiple interactions ISO CST6 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Cst6 Rat silver atom increases expression ISO Cst6 (Mus musculus) 6480464 Silver results in increased expression of CST6 mRNA CTD PMID:27131904 Cst6 Rat silver(0) increases expression ISO Cst6 (Mus musculus) 6480464 Silver results in increased expression of CST6 mRNA CTD PMID:27131904 Cst6 Rat sodium arsenate multiple interactions ISO CST6 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of CST6 mRNA CTD PMID:32525701 Cst6 Rat sodium arsenite increases expression ISO CST6 (Homo sapiens) 6480464 sodium arsenite results in increased expression of CST6 mRNA CTD PMID:38568856 Cst6 Rat sodium arsenite decreases expression ISO Cst6 (Mus musculus) 6480464 sodium arsenite results in decreased expression of CST6 mRNA CTD PMID:36209798 Cst6 Rat sodium arsenite decreases expression ISO CST6 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of CST6 mRNA CTD PMID:34032870 Cst6 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of CST6 mRNA CTD PMID:30047161 Cst6 Rat Tanshinone I increases expression ISO CST6 (Homo sapiens) 6480464 tanshinone results in increased expression of CST6 mRNA CTD PMID:15849732 Cst6 Rat tetrachloromethane increases expression ISO Cst6 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of CST6 mRNA CTD PMID:17484886 Cst6 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of CST6 mRNA CTD PMID:23411599 Cst6 Rat thiram increases expression ISO CST6 (Homo sapiens) 6480464 Thiram results in increased expression of CST6 mRNA CTD PMID:38568856 Cst6 Rat titanium dioxide increases methylation ISO Cst6 (Mus musculus) 6480464 titanium dioxide results in increased methylation of CST6 gene CTD PMID:35295148 Cst6 Rat titanium dioxide decreases methylation ISO Cst6 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of CST6 gene CTD PMID:35295148 Cst6 Rat trichostatin A increases expression ISO CST6 (Homo sapiens) 6480464 trichostatin A results in increased expression of CST6 mRNA and trichostatin A results in increased expression of CST6 protein CTD PMID:19503093 Cst6 Rat triclosan increases expression ISO CST6 (Homo sapiens) 6480464 Triclosan results in increased expression of CST6 mRNA CTD PMID:30510588 Cst6 Rat Tungsten carbide multiple interactions ISO CST6 (Homo sapiens) 6480464 [tungsten carbide binds to Cobalt] which results in increased expression of CST6 mRNA CTD PMID:20105288 Cst6 Rat zearalenone decreases expression ISO CST6 (Homo sapiens) 6480464 Zearalenone results in decreased expression of CST6 mRNA CTD PMID:28965971
17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-D (ISO) 2-hydroxypropanoic acid (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) 8-Br-cAMP (ISO) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) amiodarone (ISO) amitrole (EXP) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (EXP,ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) butan-1-ol (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) calcitriol (ISO) carbamazepine (ISO) cobalt atom (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) corosolic acid (ISO) Cuprizon (EXP) cyclosporin A (ISO) D-glucose (ISO) dexamethasone (ISO) disulfiram (ISO) diuron (EXP) dorsomorphin (ISO) endosulfan (EXP) entinostat (ISO) fenvalerate (EXP) fructose (ISO) furan (EXP) glucose (ISO) graphite (EXP) hydroquinone (ISO) L-ascorbic acid (EXP) methimazole (EXP) methotrexate (ISO) N-methyl-4-phenylpyridinium (EXP) N-nitrosodiethylamine (ISO) PCB138 (ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) potassium dichromate (ISO) rac-lactic acid (ISO) SB 431542 (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sulfadimethoxine (EXP) Tanshinone I (ISO) tetrachloromethane (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trichostatin A (ISO) triclosan (ISO) Tungsten carbide (ISO) zearalenone (ISO)
Cst6 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 212,084,676 - 212,086,384 (-) NCBI GRCr8 mRatBN7.2 1 202,655,322 - 202,657,030 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 202,655,322 - 202,657,030 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 211,008,165 - 211,009,874 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 218,100,747 - 218,102,455 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 210,791,794 - 210,793,502 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 220,727,292 - 220,729,000 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 220,727,292 - 220,729,000 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 227,656,559 - 227,658,267 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 207,991,313 - 207,993,021 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 208,144,765 - 208,146,474 (-) NCBI Celera 1 200,190,620 - 200,192,328 (-) NCBI Celera Cytogenetic Map 1 q43 NCBI
CST6 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 66,012,008 - 66,013,505 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 66,012,008 - 66,013,505 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 65,779,479 - 65,780,976 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 65,536,038 - 65,537,552 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 65,536,037 - 65,537,551 NCBI Celera 11 63,104,649 - 63,105,332 (+) NCBI Celera Cytogenetic Map 11 q13.1 NCBI HuRef 11 62,105,544 - 62,107,045 (+) NCBI HuRef CHM1_1 11 65,663,579 - 65,665,098 (+) NCBI CHM1_1 T2T-CHM13v2.0 11 66,006,130 - 66,007,628 (+) NCBI T2T-CHM13v2.0
Cst6 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 5,394,733 - 5,399,602 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 5,394,733 - 5,399,602 (-) Ensembl GRCm39 Ensembl GRCm38 19 5,344,705 - 5,349,574 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 5,344,705 - 5,349,574 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 5,344,705 - 5,349,574 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 5,344,705 - 5,349,574 (-) NCBI MGSCv36 mm8 Celera 19 5,216,597 - 5,221,470 (-) NCBI Celera Cytogenetic Map 19 A NCBI cM Map 19 4.3 NCBI
Cst6 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955422 19,313,352 - 19,327,360 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955422 19,326,302 - 19,327,449 (-) NCBI ChiLan1.0 ChiLan1.0
CST6 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 67,241,439 - 67,248,354 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 68,285,419 - 68,291,220 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 61,375,744 - 61,377,909 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 64,703,367 - 64,704,865 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 64,703,412 - 64,704,762 (+) Ensembl panpan1.1 panPan2
CST6 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 18 51,263,161 - 51,264,816 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 18 51,263,178 - 51,264,780 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 18 49,871,705 - 49,873,353 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 18 52,301,213 - 52,302,857 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 18 52,301,230 - 52,302,828 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 18 51,401,426 - 51,403,072 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 50,975,709 - 50,977,357 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 51,765,475 - 51,767,113 (-) NCBI UU_Cfam_GSD_1.0
Cst6 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 7,099,010 - 7,103,790 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936599 3,541,272 - 3,543,418 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936599 3,541,359 - 3,543,206 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CST6 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 6,323,740 - 6,325,415 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 6,323,737 - 6,325,519 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 5,427,434 - 5,429,216 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CST6 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 8,244,483 - 8,246,551 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 8,244,485 - 8,245,968 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 105,529,535 - 105,531,538 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cst6
.
Predicted Target Of
Count of predictions: 87 Count of miRNA genes: 75 Interacting mature miRNAs: 77 Transcripts: ENSRNOT00000027727 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1302787 Stl25 Serum triglyceride level QTL 25 2.7 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 180359209 210702199 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 631838 Niddm36 Non-insulin dependent diabetes mellitus QTL 36 0.01 insulin secretion trait (VT:0003564) calculated pancreatic islet insulin release measurement (CMO:0001217) 1 184550676 229550676 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1300145 Rf7 Renal function QTL 7 2.96 urine creatinine amount (VT:0010540) urine creatinine level (CMO:0000125) 1 185145134 221264292 Rat 61347 Bp197 Blood pressure QTL 197 4.2 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 1 158633083 203633083 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 1359018 Hrtrt20 Heart rate QTL 20 3.08 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 185356336 202902618 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 634312 Bp143 Blood pressure QTL 143 3 0.0002 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 182623426 219932796 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 724559 Pancm1 Pancreatic morphology QTL 1 7.1 islet of Langerhans morphology trait (VT:0005215) pancreatic islet damage composite score (CMO:0001156) 1 181759564 214537555 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 2312564 Glom18 Glomerulus QTL 18 2.4 0.003 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 185356336 231689108 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 2292218 Kidm35 Kidney mass QTL 35 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 199368955 224569684 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 1331790 Bp201 Blood pressure QTL 201 3.127 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 198211513 225126682 Rat 10059587 Bw173 Body weight QTL 173 3.23 0.025 body mass (VT:0001259) body weight (CMO:0000012) 1 202069611 247069611 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1641926 Teswt2 Testicular weight QTL 2 2.82 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 1 197697768 238755659 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1582206 Kidm33 Kidney mass QTL 33 6.9 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 188377360 224054420 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 634338 Hcar4 Hepatocarcinoma resistance QTL 4 4.6 liver integrity trait (VT:0010547) liver tumorous lesion number to liver area ratio (CMO:0001210) 1 193422268 214537671 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 2293083 Iddm25 Insulin dependent diabetes mellitus QTL 25 4.18 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 181829673 224569684 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
8
48
113
91
90
59
25
59
6
212
92
93
45
59
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000027727 ⟹ ENSRNOP00000027727
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 202,655,322 - 202,657,030 (-) Ensembl Rnor_6.0 Ensembl 1 220,727,292 - 220,729,000 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000118887 ⟹ ENSRNOP00000083652
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 202,655,322 - 202,656,798 (-) Ensembl
RefSeq Acc Id:
NM_133566 ⟹ NP_598250
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 212,084,676 - 212,086,384 (-) NCBI mRatBN7.2 1 202,655,322 - 202,657,030 (-) NCBI Rnor_6.0 1 220,727,292 - 220,729,000 (-) NCBI Rnor_5.0 1 227,656,559 - 227,658,267 (-) NCBI RGSC_v3.4 1 207,991,313 - 207,993,021 (-) RGD Celera 1 200,190,620 - 200,192,328 (-) RGD
Sequence:
GCAATTCAAACTTCAGGGCTCTGGTATGAATTGTTCTCTCCTTCCTGGATGGTAGGAATGATAGGCCAGCATCCTTACATTTAGAGGTCCGGGGGGCCTGTGTGCCACCCCTGGTTCGTACAGTGCGT
hide sequence
RefSeq Acc Id:
NP_598250 ⟸ NM_133566
- Peptide Label:
precursor
- UniProtKB:
Q8VHC1 (UniProtKB/TrEMBL), A6HZ42 (UniProtKB/TrEMBL), F7EY38 (UniProtKB/TrEMBL)
- Sequence:
MERPHFPLAMGLGLLAFCLLTLSPDARAELRSRRTGERQNLSPDDPRVLKAAQAAVASYNMDSNSLYYFRDTKVIDAKCQLVAGIKYYMTVDIESTECRKTRVSGDHVDLTTCPLAAGVQQEKLRCNF
hide sequence
Ensembl Acc Id:
ENSRNOP00000027727 ⟸ ENSRNOT00000027727
Ensembl Acc Id:
ENSRNOP00000083652 ⟸ ENSRNOT00000118887
RGD ID: 13690648 Promoter ID: EPDNEW_R1173 Type: multiple initiation site Name: Cst6_1 Description: cystatin E/M SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 220,728,741 - 220,728,801 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Cst6
cystatin E/M
Cst6
cystatin N
Name updated
1299863 APPROVED
