Symbol:
Copb2 (Ensembl: AABR07071244.1)
Name:
COPI coat complex subunit beta 2
RGD ID:
628746
Description:
Enables protein kinase C binding activity. Predicted to be involved in Golgi vesicle transport and intracellular protein transport. Located in Golgi membrane. Human ortholog(s) of this gene implicated in primary autosomal recessive microcephaly 19. Orthologous to human COPB2 (COPI coat complex subunit beta 2); INTERACTS WITH 2,4-dinitrotoluene; 2,6-dinitrotoluene; 3H-1,2-dithiole-3-thione.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
beta prime COP; beta'-coat protein; beta'-COP; coatomer protein complex subunit beta 2; coatomer protein complex, subunit beta 2 (beta prime); coatomer subunit beta'; MGC93460; p102; Rack2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 108,040,687 - 108,062,810 (+) NCBI GRCr8 mRatBN7.2 8 99,161,324 - 99,183,452 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 99,161,350 - 99,185,197 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 104,829,033 - 104,851,106 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 103,028,302 - 103,050,376 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 100,870,802 - 100,892,876 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 106,582,339 - 106,603,763 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_5.0 8 106,024,920 - 106,047,170 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 8 98,569,531 - 98,591,507 (+) NCBI Celera Cytogenetic Map 8 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Copb2 Rat (1->4)-beta-D-glucan multiple interactions ISO Copb2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of COPB2 mRNA CTD PMID:36331819 Copb2 Rat 1,2-dimethylhydrazine multiple interactions ISO Copb2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of COPB2 mRNA CTD PMID:22206623 Copb2 Rat 17alpha-ethynylestradiol increases expression ISO Copb2 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of COPB2 mRNA CTD PMID:17942748 Copb2 Rat 17alpha-ethynylestradiol multiple interactions ISO Copb2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of COPB2 mRNA CTD PMID:17942748 Copb2 Rat 17beta-estradiol increases expression ISO COPB2 (Homo sapiens) 6480464 Estradiol results in increased expression of COPB2 mRNA CTD PMID:16514628 Copb2 Rat 17beta-estradiol increases expression ISO Copb2 (Mus musculus) 6480464 Estradiol results in increased expression of COPB2 mRNA CTD PMID:39298647 Copb2 Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one multiple interactions ISO COPB2 (Homo sapiens) 6480464 Metribolone promotes the reaction [NDRG1 protein binds to COPB2 protein] CTD PMID:17220478 Copb2 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Copb2 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Copb2 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO COPB2 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Copb2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Copb2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of COPB2 mRNA CTD PMID:17942748 Copb2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Copb2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of COPB2 mRNA CTD PMID:21570461 Copb2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Copb2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of COPB2 mRNA CTD PMID:17942748 Copb2 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of COPB2 mRNA CTD PMID:21346803 Copb2 Rat 2,6-dimethoxyphenol multiple interactions ISO COPB2 (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Copb2 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of COPB2 mRNA CTD PMID:21346803 Copb2 Rat 2-hydroxypropanoic acid decreases expression ISO COPB2 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of COPB2 mRNA CTD PMID:30851411 Copb2 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Copb2 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of COPB2 mRNA CTD PMID:26251327 Copb2 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of COPB2 mRNA CTD PMID:19162173 Copb2 Rat 4,4'-sulfonyldiphenol increases expression ISO Copb2 (Mus musculus) 6480464 bisphenol S results in increased expression of COPB2 mRNA CTD PMID:39298647 Copb2 Rat 4,4'-sulfonyldiphenol increases expression ISO COPB2 (Homo sapiens) 6480464 bisphenol S results in increased expression of COPB2 protein CTD PMID:34186270 Copb2 Rat 4,4'-sulfonyldiphenol affects expression ISO COPB2 (Homo sapiens) 6480464 bisphenol S affects the expression of COPB2 protein CTD PMID:31945527 Copb2 Rat 4,4'-sulfonyldiphenol multiple interactions ISO COPB2 (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of COPB2 gene CTD PMID:31601247 Copb2 Rat 4,4'-sulfonyldiphenol increases methylation ISO COPB2 (Homo sapiens) 6480464 bisphenol S results in increased methylation of COPB2 gene CTD PMID:31601247 Copb2 Rat 4-hydroxyphenyl retinamide decreases expression ISO Copb2 (Mus musculus) 6480464 Fenretinide results in decreased expression of COPB2 mRNA CTD PMID:28973697 Copb2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of COPB2 mRNA CTD PMID:30047161 Copb2 Rat afimoxifene decreases expression ISO COPB2 (Homo sapiens) 6480464 afimoxifene results in decreased expression of COPB2 mRNA CTD PMID:16514628 Copb2 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of COPB2 mRNA CTD PMID:30047161 Copb2 Rat aristolochic acid A decreases expression ISO COPB2 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of COPB2 mRNA CTD PMID:33212167 Copb2 Rat Aroclor 1254 decreases expression ISO Copb2 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of COPB2 mRNA CTD PMID:23650126 Copb2 Rat arsenous acid increases expression ISO COPB2 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of COPB2 protein CTD PMID:25419056 Copb2 Rat atrazine increases expression ISO COPB2 (Homo sapiens) 6480464 Atrazine results in increased expression of COPB2 mRNA CTD PMID:22378314 Copb2 Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of COPB2 mRNA CTD PMID:21839799 Copb2 Rat beta-lapachone decreases expression ISO COPB2 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of COPB2 mRNA CTD PMID:38218311 Copb2 Rat bicalutamide increases expression ISO COPB2 (Homo sapiens) 6480464 bicalutamide results in increased expression of COPB2 mRNA CTD PMID:16631469 Copb2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Copb2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of COPB2 mRNA CTD PMID:33754040 Copb2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of COPB2 mRNA CTD PMID:25181051 Copb2 Rat bisphenol A increases expression ISO COPB2 (Homo sapiens) 6480464 bisphenol A results in increased expression of COPB2 protein CTD PMID:37567409 Copb2 Rat bisphenol A decreases expression ISO COPB2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of COPB2 protein CTD PMID:34186270 Copb2 Rat bisphenol AF increases expression ISO COPB2 (Homo sapiens) 6480464 bisphenol AF results in increased expression of COPB2 protein CTD PMID:34186270 Copb2 Rat Bisphenol B increases expression ISO COPB2 (Homo sapiens) 6480464 bisphenol B results in increased expression of COPB2 protein CTD PMID:34186270 Copb2 Rat bisphenol F increases expression ISO Copb2 (Mus musculus) 6480464 bisphenol F results in increased expression of COPB2 mRNA CTD PMID:38685157 Copb2 Rat caffeine increases phosphorylation ISO COPB2 (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of COPB2 protein CTD PMID:35688186 Copb2 Rat captan increases expression ISO Copb2 (Mus musculus) 6480464 Captan results in increased expression of COPB2 mRNA CTD PMID:31558096 Copb2 Rat cisplatin decreases expression ISO COPB2 (Homo sapiens) 6480464 Cisplatin results in decreased expression of COPB2 mRNA CTD PMID:27594783 Copb2 Rat clofibrate multiple interactions ISO Copb2 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of COPB2 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of COPB2 mRNA] CTD PMID:17585979 Copb2 Rat clofibrate decreases expression ISO Copb2 (Mus musculus) 6480464 Clofibrate results in decreased expression of COPB2 mRNA CTD PMID:17585979 Copb2 Rat cyclosporin A increases expression ISO COPB2 (Homo sapiens) 6480464 Cyclosporine results in increased expression of COPB2 mRNA CTD PMID:20106945 Copb2 Rat dexamethasone multiple interactions EXP 6480464 Testosterone inhibits the reaction [Dexamethasone results in decreased expression of COPB2 mRNA] CTD PMID:20032058 Copb2 Rat dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of COPB2 mRNA CTD PMID:20032058 Copb2 Rat diarsenic trioxide increases expression ISO COPB2 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of COPB2 protein CTD PMID:25419056 Copb2 Rat diazinon increases methylation ISO COPB2 (Homo sapiens) 6480464 Diazinon results in increased methylation of COPB2 gene CTD PMID:22964155 Copb2 Rat dicrotophos decreases expression ISO COPB2 (Homo sapiens) 6480464 dicrotophos results in decreased expression of COPB2 mRNA CTD PMID:28302478 Copb2 Rat ethanol affects splicing ISO Copb2 (Mus musculus) 6480464 Ethanol affects the splicing of COPB2 mRNA CTD PMID:30319688 Copb2 Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of COPB2 mRNA CTD PMID:18035473 Copb2 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of COPB2 mRNA CTD PMID:24136188 Copb2 Rat folic acid multiple interactions ISO Copb2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of COPB2 mRNA CTD PMID:22206623 Copb2 Rat folpet increases expression ISO Copb2 (Mus musculus) 6480464 folpet results in increased expression of COPB2 mRNA CTD PMID:31558096 Copb2 Rat FR900359 increases phosphorylation ISO COPB2 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of COPB2 protein CTD PMID:37730182 Copb2 Rat fulvestrant decreases expression ISO COPB2 (Homo sapiens) 6480464 fulvestrant results in decreased expression of COPB2 mRNA CTD PMID:16514628 Copb2 Rat fulvestrant multiple interactions ISO COPB2 (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of COPB2 gene CTD PMID:31601247 Copb2 Rat furfural multiple interactions ISO COPB2 (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Copb2 Rat hydrogen peroxide affects expression ISO COPB2 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of COPB2 mRNA CTD PMID:20044591 Copb2 Rat inulin multiple interactions ISO Copb2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of COPB2 mRNA CTD PMID:36331819 Copb2 Rat ivermectin decreases expression ISO COPB2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of COPB2 protein CTD PMID:32959892 Copb2 Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of COPB2 mRNA CTD PMID:32035215 Copb2 Rat methidathion increases expression ISO Copb2 (Mus musculus) 6480464 methidathion results in increased expression of COPB2 mRNA CTD PMID:34813904 Copb2 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of COPB2 mRNA CTD PMID:30047161 Copb2 Rat miconazole increases expression ISO Copb2 (Mus musculus) 6480464 Miconazole results in increased expression of COPB2 mRNA CTD PMID:27462272 Copb2 Rat N-methyl-4-phenylpyridinium decreases expression ISO Copb2 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of COPB2 protein CTD PMID:26558463 Copb2 Rat nickel atom decreases expression ISO COPB2 (Homo sapiens) 6480464 Nickel results in decreased expression of COPB2 mRNA CTD PMID:23195993 Copb2 Rat nitrates multiple interactions ISO Copb2 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of COPB2 mRNA CTD PMID:35964746 Copb2 Rat ozone multiple interactions ISO COPB2 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of COPB2 mRNA CTD PMID:35430440 Copb2 Rat paracetamol increases expression ISO Copb2 (Mus musculus) 6480464 Acetaminophen results in increased expression of COPB2 mRNA CTD PMID:17585979 Copb2 Rat paracetamol affects expression ISO Copb2 (Mus musculus) 6480464 Acetaminophen affects the expression of COPB2 mRNA CTD PMID:17562736 Copb2 Rat paracetamol multiple interactions ISO Copb2 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of COPB2 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of COPB2 mRNA] CTD PMID:17585979 Copb2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Copb2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of COPB2 mRNA more ... CTD PMID:36331819 Copb2 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of COPB2 mRNA CTD PMID:30047161 Copb2 Rat picoxystrobin increases expression ISO COPB2 (Homo sapiens) 6480464 picoxystrobin results in increased expression of COPB2 mRNA CTD PMID:33512557 Copb2 Rat rac-lactic acid decreases expression ISO COPB2 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of COPB2 mRNA CTD PMID:30851411 Copb2 Rat raloxifene decreases expression ISO COPB2 (Homo sapiens) 6480464 Raloxifene Hydrochloride results in decreased expression of COPB2 mRNA CTD PMID:16514628 Copb2 Rat resveratrol multiple interactions ISO COPB2 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of COPB2 mRNA CTD PMID:23557933 Copb2 Rat Salinomycin decreases expression ISO COPB2 (Homo sapiens) 6480464 salinomycin results in decreased expression of COPB2 mRNA CTD PMID:19682730 Copb2 Rat sodium arsenate increases expression ISO Copb2 (Mus musculus) 6480464 sodium arsenate results in increased expression of COPB2 mRNA CTD PMID:30953684 Copb2 Rat sodium arsenite increases expression ISO COPB2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of COPB2 mRNA CTD PMID:38568856 Copb2 Rat sodium arsenite decreases expression ISO COPB2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of COPB2 protein CTD PMID:30528433 Copb2 Rat sodium chloride multiple interactions ISO COPB2 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of COPB2 protein more ... CTD PMID:38598786 Copb2 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of COPB2 mRNA CTD PMID:30047161 Copb2 Rat testosterone multiple interactions EXP 6480464 Testosterone inhibits the reaction [Dexamethasone results in decreased expression of COPB2 mRNA] CTD PMID:20032058 Copb2 Rat testosterone decreases expression ISO Copb2 (Mus musculus) 6480464 Testosterone deficiency results in decreased expression of COPB2 mRNA CTD PMID:33848595 Copb2 Rat tetrachloromethane increases expression ISO Copb2 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of COPB2 mRNA CTD PMID:31919559 Copb2 Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of COPB2 protein CTD PMID:35544339 Copb2 Rat trichloroethene increases expression ISO Copb2 (Mus musculus) 6480464 Trichloroethylene results in increased expression of COPB2 mRNA CTD PMID:19448997 Copb2 Rat tunicamycin increases expression ISO COPB2 (Homo sapiens) 6480464 Tunicamycin results in increased expression of COPB2 mRNA CTD PMID:22378314 Copb2 Rat valproic acid increases expression ISO COPB2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of COPB2 mRNA CTD PMID:19101580 Copb2 Rat valproic acid affects expression ISO COPB2 (Homo sapiens) 6480464 Valproic Acid affects the expression of COPB2 mRNA CTD PMID:25979313
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) afimoxifene (ISO) amitrole (EXP) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsenous acid (ISO) atrazine (ISO) benzo[a]pyrene (EXP) beta-lapachone (ISO) bicalutamide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) caffeine (ISO) captan (ISO) cisplatin (ISO) clofibrate (ISO) cyclosporin A (ISO) dexamethasone (EXP) diarsenic trioxide (ISO) diazinon (ISO) dicrotophos (ISO) ethanol (ISO) flavonoids (EXP) flutamide (EXP) folic acid (ISO) folpet (ISO) FR900359 (ISO) fulvestrant (ISO) furfural (ISO) hydrogen peroxide (ISO) inulin (ISO) ivermectin (ISO) methamphetamine (EXP) methidathion (ISO) methimazole (EXP) miconazole (ISO) N-methyl-4-phenylpyridinium (ISO) nickel atom (ISO) nitrates (ISO) ozone (ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (EXP) picoxystrobin (ISO) rac-lactic acid (ISO) raloxifene (ISO) resveratrol (ISO) Salinomycin (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium chloride (ISO) sulfadimethoxine (EXP) testosterone (EXP,ISO) tetrachloromethane (ISO) thapsigargin (EXP) trichloroethene (ISO) tunicamycin (ISO) valproic acid (ISO)
1.
A systematic analysis of 40 random genes in cultured vascular smooth muscle subtypes reveals a heterogeneity of gene expression and identifies the tight junction gene zonula occludens 2 as a marker of epithelioid "pup" smooth muscle cells and a participant in carotid neointimal formation.
Adams LD, etal., Arterioscler Thromb Vasc Biol 1999 Nov;19(11):2600-8.
2.
Scyl1, mutated in a recessive form of spinocerebellar neurodegeneration, regulates COPI-mediated retrograde traffic.
Burman JL, etal., J Biol Chem. 2008 Aug 15;283(33):22774-86. doi: 10.1074/jbc.M801869200. Epub 2008 Jun 13.
3.
The coatomer protein beta'-COP, a selective binding protein (RACK) for protein kinase Cepsilon.
Csukai M, etal., J Biol Chem 1997 Nov 14;272(46):29200-6.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Mammalian Bet3 functions as a cytosolic factor participating in transport from the ER to the Golgi apparatus.
Loh E, etal., J Cell Sci. 2005 Mar 15;118(Pt 6):1209-22. Epub 2005 Feb 22.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
GOA pipeline
RGD automated data pipeline
9.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Copb2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 108,040,687 - 108,062,810 (+) NCBI GRCr8 mRatBN7.2 8 99,161,324 - 99,183,452 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 99,161,350 - 99,185,197 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 104,829,033 - 104,851,106 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 103,028,302 - 103,050,376 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 100,870,802 - 100,892,876 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 106,582,339 - 106,603,763 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_5.0 8 106,024,920 - 106,047,170 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 8 98,569,531 - 98,591,507 (+) NCBI Celera Cytogenetic Map 8 q31 NCBI
COPB2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 139,357,406 - 139,389,680 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 139,353,946 - 139,389,736 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 139,076,248 - 139,108,522 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 140,559,123 - 140,591,151 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 140,559,132 - 140,591,159 NCBI Celera 3 137,499,384 - 137,531,480 (-) NCBI Celera Cytogenetic Map 3 q23 NCBI HuRef 3 136,451,880 - 136,483,977 (-) NCBI HuRef CHM1_1 3 139,039,998 - 139,072,089 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 142,104,959 - 142,137,239 (-) NCBI T2T-CHM13v2.0
Copb2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 98,445,784 - 98,470,428 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 98,445,774 - 98,470,435 (+) Ensembl GRCm39 Ensembl GRCm38 9 98,563,731 - 98,588,375 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 98,563,721 - 98,588,382 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 98,464,150 - 98,488,794 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 98,373,083 - 98,397,727 (+) NCBI MGSCv36 mm8 Celera 9 98,109,355 - 98,134,004 (+) NCBI Celera Cytogenetic Map 9 E3.3 NCBI cM Map 9 51.4 NCBI
Copb2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955508 6,201,989 - 6,231,845 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955508 6,201,989 - 6,231,840 (+) NCBI ChiLan1.0 ChiLan1.0
COPB2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 137,271,754 - 137,303,751 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 137,272,816 - 137,308,481 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 136,394,480 - 136,426,544 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 143,994,312 - 144,026,277 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 143,994,312 - 144,020,117 (-) Ensembl panpan1.1 panPan2
COPB2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 23 35,536,520 - 35,604,708 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 23 35,536,615 - 35,566,569 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 23 35,524,048 - 35,592,583 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 23 36,075,179 - 36,143,336 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 23 36,074,618 - 36,143,348 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 23 35,755,206 - 35,823,768 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 23 35,828,808 - 35,896,988 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 23 36,070,552 - 36,139,285 (-) NCBI UU_Cfam_GSD_1.0
Copb2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 74,727,380 - 74,753,469 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936540 1,467,169 - 1,493,258 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936540 1,467,169 - 1,493,218 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
COPB2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 80,218,989 - 80,264,762 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 80,220,460 - 80,264,808 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 87,894,952 - 87,931,027 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
COPB2
Copb2
.
Predicted Target Of
Count of predictions: 23 Count of miRNA genes: 22 Interacting mature miRNAs: 23 Transcripts: ENSRNOT00000075603 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300177 Cm2 Cardiac mass QTL 2 3.65 heart mass (VT:0007028) heart weight (CMO:0000017) 8 54259986 100382532 Rat 1549909 Stresp11 Stress response QTL 11 6.83 0.0019 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 8 73473045 118473045 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 9590292 Uminl3 Urine mineral level QTL 3 3.62 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 8 71888757 116888757 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 738011 Anxrr9 Anxiety related response QTL 9 6.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 8 93535351 123900184 Rat 8693654 Alc32 Alcohol consumption QTL 32 2 0.755 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 8 88612425 107550209 Rat 1358912 Bw51 Body weight QTL 51 2.95 body mass (VT:0001259) body weight (CMO:0000012) 8 51351728 107062046 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 738014 Anxrr15 Anxiety related response QTL 15 3.6 0.005 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 95718998 123900184 Rat 1300171 Bp184 Blood pressure QTL 184 3.66 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 8 70513503 118219066 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 2313400 Anxrr25 Anxiety related response QTL 25 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 8 89265192 114019816 Rat 2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 631210 Bw3 Body weight QTL3 5.9 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 8 69349194 112783834 Rat 1358903 Bp252 Blood pressure QTL 252 7 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 8694446 Bw170 Body weight QTL 170 12.07 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 8 71888757 116888757 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 631653 Bp125 Blood pressure QTL 125 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 66142385 111142385 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 2300182 Bmd56 Bone mineral density QTL 56 5.4 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 95718998 123900184 Rat 2300181 Bmd55 Bone mineral density QTL 55 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 76468691 121468691 Rat 1358893 Bp263 Blood pressure QTL 263 5.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 8694200 Abfw4 Abdominal fat weight QTL 4 9.07 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 8 71888757 116888757 Rat 8694392 Bw161 Body weight QTL 161 8.06 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 8 71888757 116888757 Rat 61437 Cia6 Collagen induced arthritis QTL 6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 8 82460758 122812818 Rat
RH129978
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 99,183,240 - 99,183,443 (+) MAPPER mRatBN7.2 Rnor_6.0 8 106,603,550 - 106,603,754 NCBI Rnor6.0 Celera 8 98,591,295 - 98,591,498 UniSTS RH 3.4 Map 8 1051.7 UniSTS
AU048956
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 99,163,041 - 99,163,284 (+) MAPPER mRatBN7.2 Rnor_6.0 8 106,584,071 - 106,584,313 NCBI Rnor6.0 Celera 8 98,571,234 - 98,571,480 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSRNOT00000080434 ⟹ ENSRNOP00000071536
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 99,165,660 - 99,181,530 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000101351 ⟹ ENSRNOP00000094254
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 99,161,350 - 99,185,197 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000115328 ⟹ ENSRNOP00000088501
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 99,165,521 - 99,185,197 (+) Ensembl
RefSeq Acc Id:
NM_021765 ⟹ NP_068533
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 108,040,687 - 108,062,810 (+) NCBI mRatBN7.2 8 99,161,324 - 99,183,452 (+) NCBI Rnor_6.0 8 106,582,339 - 106,603,763 (+) NCBI Rnor_5.0 8 106,024,920 - 106,047,170 (+) NCBI Celera 8 98,569,531 - 98,591,507 (+) RGD
Sequence:
AGGTTCCACTGCTCCGTGGGTCTGTGTGTTCTTGAGTACCAGTGTCGCTCGGAGCCTGTGAGAGGCTGGGGCTCGGACAATCGGAGCCATGCCTCTTCGACTTGACATCAAGAGAAAGCTAACTGCTA
hide sequence
RefSeq Acc Id:
NP_068533 ⟸ NM_021765
- UniProtKB:
A0A8I6GKN2 (UniProtKB/TrEMBL), A6I2B6 (UniProtKB/TrEMBL), Q5M7X1 (UniProtKB/TrEMBL)
- Sequence:
MPLRLDIKRKLTAMSDRVKSVDLHPTEPWMLASLYNGSVCVWNHETQTLVKTFEVCDLPVRAAKFVARKNWVVTGADDMQIRVFNYNTLERVHMFEAHSDYIRCIAVHPTQPFILTSSDDMLIKLWDW
hide sequence
Ensembl Acc Id:
ENSRNOP00000071536 ⟸ ENSRNOT00000080434
Ensembl Acc Id:
ENSRNOP00000094254 ⟸ ENSRNOT00000101351
Ensembl Acc Id:
ENSRNOP00000088501 ⟸ ENSRNOT00000115328
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-11-11
Copb2
COPI coat complex subunit beta 2
Copb2
coatomer protein complex subunit beta 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-04-13
Copb2
coatomer protein complex subunit beta 2
Copb2
coatomer protein complex, subunit beta 2 (beta prime)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Copb2
coatomer protein complex, subunit beta 2 (beta prime)
beta prime COP
Name updated
1299863 APPROVED
2003-02-27
Copb2
beta prime COP
Symbol and Name status set to provisional
70820 PROVISIONAL
