Advanced Search (OLGA)

Gene: Pofut4 (protein O-fucosyltransferase 4) Rattus norvegicus

Analyze

Symbol:

Pofut4 (Ensembl: Fut11)

Name:

protein O-fucosyltransferase 4 (Ensembl:fucosyltransferase 11)

RGD ID:

628731

Description:

Predicted to enable alpha-(1->3)-fucosyltransferase activity and peptide-O-fucosyltransferase activity. Predicted to be involved in N-glycan processing and positive regulation of protein secretion. Predicted to be located in Golgi membrane and endoplasmic reticulum membrane. Predicted to be active in endoplasmic reticulum. Human ortholog(s) of this gene implicated in stomach cancer. Orthologous to human POFUT4 (protein O-fucosyltransferase 4); INTERACTS WITH (-)-demecolcine (ortholog); 2-hydroxypropanoic acid (ortholog); 4,4'-sulfonyldiphenol (ortholog).

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

alpha-(1,3)-fucosyltransferase 11; alpha3-fucosyltransferase 11; fuc-TXI; fucosyltransferase 11; fucosyltransferase 11 (alpha (1,3) fucosyltransferase); fucosyltransferase XI; fucT-XI; Fut11; galactoside 3-L-fucosyltransferase 11; GDP-fucose protein O-fucosyltransferase 4; MGC94472

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	POFUT4 (protein O-fucosyltransferase 4)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Pofut4 (protein O-fucosyltransferase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pofut4 (protein O-fucosyltransferase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	POFUT4 (protein O-fucosyltransferase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FUT11 (fucosyltransferase 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pofut4 (protein O-fucosyltransferase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FUT11 (fucosyltransferase 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	POFUT4 (protein O-fucosyltransferase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pofut4 (protein O-fucosyltransferase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Pofut4 (protein O-fucosyltransferase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	POFUT4 (protein O-fucosyltransferase 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pofut4 (protein O-fucosyltransferase 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fut11 (fucosyltransferase 11 (alpha (1,3) fucosyltransferase))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	FucTB	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	FucTB	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	fut11	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	3,648,022 - 3,651,582 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	3,643,009 - 3,651,610 (-)	Ensembl				GRCr8
mRatBN7.2	15	3,598,768 - 3,602,328 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	3,598,758 - 3,602,356 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	15	3,608,959 - 3,612,519 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	4,995,435 - 4,998,995 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	3,607,768 - 3,611,328 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	15	3,598,035 - 3,601,593 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	15	4,190,674 - 4,194,229 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	15	3,605,536 - 3,609,091 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	15	3,645,426 - 3,648,986 (-)	NCBI		F344_StmMcwi
Rnor_6.0	15	4,031,504 - 4,035,064 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	4,031,504 - 4,035,064 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	15	8,132,722 - 8,136,282 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	3,824,218 - 3,827,778 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	991,857 - 995,417 (+)	NCBI		Celera
RGSC_v3.1	15	3,824,207 - 3,827,806 (-)	NCBI
Cytogenetic Map	15	p16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

stomach cancer (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2-hydroxypropanoic acid (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsenous acid (ISO)

bisphenol A (EXP)

bisphenol F (ISO)

Butylbenzyl phthalate (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dimethylarsinic acid (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

fluoranthene (ISO)

folic acid (ISO)

formaldehyde (ISO)

gentamycin (EXP)

leflunomide (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

mono(2-ethylhexyl) phthalate (ISO)

pentanal (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sotorasib (ISO)

succimer (ISO)

sunitinib (ISO)

thimerosal (ISO)

titanium dioxide (ISO)

trametinib (ISO)

triclosan (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

vincristine (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

glycoprotein biosynthetic process (IEA)

N-glycan processing (ISO,ISS)

positive regulation of protein secretion (IEA,ISO,ISS)

protein O-linked glycosylation via fucose (IEA)

Cellular Component

endoplasmic reticulum (IEA,ISO,ISS)

endoplasmic reticulum membrane (IEA)

Golgi membrane (IEA)

membrane (IEA)

Molecular Function

alpha-(1->3)-fucosyltransferase activity (IBA,IEA)

fucosyltransferase activity (IEA,ISO,ISS)

glycosyltransferase activity (IEA)

peptide-O-fucosyltransferase activity (IEA,ISO,ISS)

protein binding (ISO)

transferase activity (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Knockdown of FUT11 inhibits the progression of gastric cancer via the PI3K/AKT pathway.	Cao W, etal., Heliyon. 2023 Jul 7;9(7):e17600. doi: 10.1016/j.heliyon.2023.e17600. eCollection 2023 Jul.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Composition of Drosophila melanogaster proteome involved in fucosylated glycan metabolism.	Roos C, etal., J Biol Chem 2002 Feb 1;277(5):3168-75. Epub 2001 Nov 6.
7.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:19088067	PMID:23376485

Genomics

Comparative Map Data

Pofut4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	3,648,022 - 3,651,582 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	3,643,009 - 3,651,610 (-)	Ensembl				GRCr8
mRatBN7.2	15	3,598,768 - 3,602,328 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	3,598,758 - 3,602,356 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	15	3,608,959 - 3,612,519 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	4,995,435 - 4,998,995 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	3,607,768 - 3,611,328 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	15	3,598,035 - 3,601,593 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	15	4,190,674 - 4,194,229 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	15	3,605,536 - 3,609,091 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	15	3,645,426 - 3,648,986 (-)	NCBI		F344_StmMcwi
Rnor_6.0	15	4,031,504 - 4,035,064 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	4,031,504 - 4,035,064 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	15	8,132,722 - 8,136,282 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	3,824,218 - 3,827,778 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	991,857 - 995,417 (+)	NCBI		Celera
RGSC_v3.1	15	3,824,207 - 3,827,806 (-)	NCBI
Cytogenetic Map	15	p16	NCBI

POFUT4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	73,772,276 - 73,780,254 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	73,772,276 - 73,780,251 (+)	Ensembl			hg38	GRCh38
GRCh37	10	75,532,034 - 75,535,977 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	75,202,055 - 75,205,983 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	10	75,202,054 - 75,205,980	NCBI
Celera	10	68,815,227 - 68,819,145 (+)	NCBI		Celera
Cytogenetic Map	10	q22.2	NCBI
HuRef	10	69,527,224 - 69,531,120 (+)	NCBI		HuRef
CHM1_1	10	75,813,820 - 75,817,752 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	74,643,692 - 74,651,652 (+)	NCBI		T2T-CHM13v2.0

Pofut4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	20,745,036 - 20,750,265 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	20,745,036 - 20,751,084 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	14	20,694,968 - 20,700,197 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	20,694,968 - 20,701,016 (+)	Ensembl			mm10	GRCm38
MGSCv37	14	21,514,190 - 21,519,419 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	14	19,483,520 - 19,488,749 (+)	NCBI		MGSCv36	mm8
Celera	14	17,077,738 - 17,082,963 (+)	NCBI		Celera
Cytogenetic Map	14	A3	NCBI
cM Map	14	11.53	NCBI

Pofut4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955437	18,126,167 - 18,132,805 (-)	Ensembl
ChiLan1.0	NW_004955437	18,126,165 - 18,132,874 (-)	NCBI	ChiLan1.0	ChiLan1.0

POFUT4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	85,923,086 - 85,931,133 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	85,928,410 - 85,936,457 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	70,295,122 - 70,301,897 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	72,967,970 - 72,974,517 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	72,968,025 - 72,972,030 (+)	Ensembl			panPan2	panpan1.1

FUT11
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	24,209,235 - 24,213,192 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	24,209,271 - 24,212,515 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	24,346,846 - 24,352,467 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	24,489,372 - 24,495,211 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	24,489,388 - 24,492,854 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	24,386,557 - 24,392,344 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	24,587,177 - 24,592,794 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	24,942,244 - 24,947,858 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Pofut4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	56,874,870 - 56,881,772 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936521	5,369,174 - 5,374,428 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936521	5,367,614 - 5,374,472 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FUT11
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	76,498,827 - 76,505,767 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	76,497,894 - 76,505,776 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	82,625,856 - 82,629,556 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

POFUT4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	57,593,732 - 57,600,704 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	57,597,011 - 57,600,617 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666048	18,169,493 - 18,177,902 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pofut4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624754	7,288,945 - 7,293,786 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624754	7,288,879 - 7,294,832 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Pofut4
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	12	90,502,772 - 90,506,397 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Pofut4
8 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	85
Count of miRNA genes:	73
Interacting mature miRNAs:	77
Transcripts:	ENSRNOT00000012300
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1641913	Colcr2	Colorectal carcinoma resistance QTL 2	6.57	0.0197	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	15	2315759	47315759	Rat
10401805	Kidm51	Kidney mass QTL 51			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	15	2785923	47785923	Rat
5684946	Bss98	Bone structure and strength QTL 98	3.9	0.0026	tibia strength trait (VT:1000284)	tibia ultimate force (CMO:0001734)	15	1	39411584	Rat
1354657	Despr13	Despair related QTL 13		0.0022	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	15	1	32342855	Rat
1641887	Alcrsp14	Alcohol response QTL 14			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	15	1	44836456	Rat
738017	Hcas7	Hepatocarcinoma susceptibility QTL 7	2.91		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	15	2315759	53331089	Rat
1300142	Bp191	Blood pressure QTL 191	3.14		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	15	1	15177511	Rat

Markers in Region

RH128878

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	3,602,527 - 3,602,710 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	4,035,264 - 4,035,446	NCBI	Rnor6.0
Rnor_5.0	15	8,136,482 - 8,136,664	UniSTS	Rnor5.0
RGSC_v3.4	15	3,827,978 - 3,828,160	UniSTS	RGSC3.4
Celera	15	991,475 - 991,657	UniSTS
RH 3.4 Map	15	65.8	UniSTS
Cytogenetic Map	15	p16	UniSTS

RH139808

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	3,600,960 - 3,601,149 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	4,033,697 - 4,033,885	NCBI	Rnor6.0
Rnor_5.0	15	8,134,915 - 8,135,103	UniSTS	Rnor5.0
RGSC_v3.4	15	3,826,411 - 3,826,599	UniSTS	RGSC3.4
Celera	15	993,036 - 993,224	UniSTS
RH 3.4 Map	15	66.2	UniSTS
Cytogenetic Map	15	p16	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
9	11	49	113	91	90	59	25	59	6	218	97	11	93	45	60	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_173308	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC127920	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ535753	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC079316	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474061	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000012300 ⟹ ENSRNOP00000012300

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	15	3,648,012 - 3,651,610 (-)	Ensembl
mRatBN7.2 Ensembl	15	3,598,758 - 3,602,356 (-)	Ensembl
Rnor_6.0 Ensembl	15	4,031,504 - 4,035,064 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000155893 ⟹ ENSRNOP00000099856

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	15	3,643,009 - 3,651,610 (-)	Ensembl

RefSeq Acc Id:

NM_173308 ⟹ NP_775430

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	3,648,022 - 3,651,582 (-)	NCBI
mRatBN7.2	15	3,598,768 - 3,602,328 (-)	NCBI
Dahl_SR_JrHsd	15	3,598,035 - 3,601,593 (-)	NCBI
Lyon_Normotensive	15	4,190,674 - 4,194,229 (-)	NCBI
Lyon_Hypertensive	15	3,605,536 - 3,609,091 (-)	NCBI
F344_StmMcwi	15	3,645,426 - 3,648,986 (-)	NCBI
Rnor_6.0	15	4,031,504 - 4,035,064 (-)	NCBI
Rnor_5.0	15	8,132,722 - 8,136,282 (-)	NCBI
RGSC_v3.4	15	3,824,218 - 3,827,778 (-)	RGD
Celera	15	991,857 - 995,417 (+)	RGD

Sequence:

show sequence

GTGGGTCCAGTGTGGACATGGCCGCTCGCTACACCGAGGCGGTGTTGGCCGCCCTGGGGGTGCT
CAGTGTCTGTTCGGCCAGCAGCAGCTCCGGGTCTGGGGCATCGGGGAAGGCGGGTGGGGAGGCT
GAGTGGGCGGAGCCGTGGGATGGCGCGGTTTTCCGGCCGCCGGCTGCATTAGGAGCCGTGGGGA
TGACGCGCGGGCTGGGATCACCGCCGCCGGGGAACGCAGAGACCGTGGACCTACCAGTGTTGCT
GTGGTGGAGTCCAGGCCTGTTTCCGCACTTCCCAGGTGACTCGGAGCGCATAGAGTGTGCGCTC
GGCGCGTGCGTGGCGTCCCGGGATCGACGGGCGCGCGCCGACCCGCGGACGCGCGCATTGCTTT
TTTACGGCACAGACTTCCGCGCGGCTGACGCACCCCTGCCGCGCCTGGCGCACCAGAGCTGGGC
GCTCCTGCACGAGGAGTCGCCACTCAACAACTTCCTGCTGAGCCACGGCCCGGGCATCCGCCTC
TTCAATCTCACGGCCACCTTCAGCCGCCACTCGGACTATCCGCTGCCGTTGCAGTGGCTGCCTG
GGGCGGCCTATTTGCGCCGGCCCGCACCTCCGCTCCGGGAGCGCGCCGAATGGCGTCGCCGCGG
GTACGCGCCGCTGCTCTATTTGCAGTCCCACTGCGACGTGCCTTCCGACCGGGACCGCTACGTA
CGCGAGCTCATGCGCTACATCCCGGTGGATTCCTATGGCAAGTGCCTGCAGAACCGCGAGCCGC
CCACCGTGCGGTTACAGGACACAGCTACGGCCACCACCGAGGATCCAGAACTCATGGCTTTTTT
GTCCCGCTATAAGTTCCACTTGGCCATGGAAAATGCCATCTGCAATGATTACATGACAGAAAAA
CTGTGGCGCCCCATGCATCTGGGTGCTGTGCCTGTGTATCGTGGATCACCCTCTGTGAGGGACT
GGATGCCCAATAATCACTCCGTCATCCTAATTGATGACTTTGAGTCCCCTCAAAAGTTGGCAGA
GTTTATTGACTTTCTGGACAAAAACGATGAAGAGTATATGAAATACCTGGCGTACAAGCAGCCT
GGGGGCATCACCAACCAGTTTCTTCTGGATAACCTGGAGCACAGGGAGTGGGGAGTGAATGATC
CCATGTTGCCCAACTACCTCAATGGCTTTGAGTGTTTCGTCTGTGACCATGAACTGGCTCGGCT
GGATGCCGAGAAAGCACATGAATCCTCTCCTAGGGACATTCCTGTCCTTGAGCCTCACATTGCT
CAGTTGTCACACATGGACTGTCCAGTGCCTACCCCTGGCTTTGGGAAAGTCGAAGAGATTCCTG
AGAACGACAGCTGGAAGGAAATGTGGCTACAAGATTACTGGCAAGGTCTCTATCAGGGGGAAGC
TCTCACTGCCATGATCCACAACAATGAGACACAGCAGAGCAAATTTTGGGATTACGTACACGAG
ATCTTCATGAAAAGGAATAAAAATCTCTAACTGTCAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_775430	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79316	(Get FASTA)	NCBI Sequence Viewer
	CAD59737	(Get FASTA)	NCBI Sequence Viewer
	EDL86242	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000012300
	ENSRNOP00000012300.1
GenBank Protein	Q68FV3	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_775430 ⟸ NM_173308
- Peptide Label:	precursor
- UniProtKB:	Q8CG40 (UniProtKB/Swiss-Prot), Q68FV3 (UniProtKB/Swiss-Prot), A6KKP8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAARYTEAVLAALGVLSVCSASSSSGSGASGKAGGEAEWAEPWDGAVFRPPAALGAVGMTRGLG SPPPGNAETVDLPVLLWWSPGLFPHFPGDSERIECALGACVASRDRRARADPRTRALLFYGTDF RAADAPLPRLAHQSWALLHEESPLNNFLLSHGPGIRLFNLTATFSRHSDYPLPLQWLPGAAYLR RPAPPLRERAEWRRRGYAPLLYLQSHCDVPSDRDRYVRELMRYIPVDSYGKCLQNREPPTVRLQ DTATATTEDPELMAFLSRYKFHLAMENAICNDYMTEKLWRPMHLGAVPVYRGSPSVRDWMPNNH SVILIDDFESPQKLAEFIDFLDKNDEEYMKYLAYKQPGGITNQFLLDNLEHREWGVNDPMLPNY LNGFECFVCDHELARLDAEKAHESSPRDIPVLEPHIAQLSHMDCPVPTPGFGKVEEIPENDSWK EMWLQDYWQGLYQGEALTAMIHNNETQQSKFWDYVHEIFMKRNKNL hide sequence

Ensembl Acc Id:

ENSRNOP00000012300 ⟸ ENSRNOT00000012300

Ensembl Acc Id:

ENSRNOP00000099856 ⟸ ENSRNOT00000155893

Protein Domains

Fucosyltransferase C-terminal Fucosyltransferase N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q68FV3-F1-model_v2	AlphaFold	Q68FV3	1-494	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699561

Promoter ID:

EPDNEW_R10084

Type:

multiple initiation site

Name:

Fut11_1

Description:

fucosyltransferase 11

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	15	4,035,076 - 4,035,136	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:628731	AgrOrtholog
BioCyc Gene	G2FUF-14556	BioCyc
Ensembl Genes	ENSRNOG00000009274	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000012300	ENTREZGENE
	ENSRNOT00000012300.4	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.11660	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7135022	IMAGE-MGC_LOAD
InterPro	Alpha-1_3-FUT_met	UniProtKB/Swiss-Prot
	Glyco_tran_10_C	UniProtKB/Swiss-Prot
	Glyco_tran_10_N	UniProtKB/Swiss-Prot
	Glyco_trans_10	UniProtKB/Swiss-Prot
	GT10-like_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:286971	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94472	IMAGE-MGC_LOAD
NCBI Gene	286971	ENTREZGENE
PANTHER	ALPHA-(1,3)-FUCOSYLTRANSFERASE 11	UniProtKB/Swiss-Prot
	PTHR11929	UniProtKB/Swiss-Prot
Pfam	Glyco_tran_10_N	UniProtKB/Swiss-Prot
	Glyco_transf_10	UniProtKB/Swiss-Prot
PhenoGen	Pofut4	PhenoGen
PIRSF	Alpha1_3FUT_met	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000009274	RatGTEx
Superfamily-SCOP	UDP-Glycosyltransferase/glycogen phosphorylase	UniProtKB/Swiss-Prot
UniProt	A0ABK0LG46_RAT	UniProtKB/TrEMBL
	A6KKP8	ENTREZGENE, UniProtKB/TrEMBL
	FUT11_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q8CG40	ENTREZGENE
UniProt Secondary	Q8CG40	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2025-11-13	Pofut4	protein O-fucosyltransferase 4	Fut11	fucosyltransferase 11	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-04-13	Fut11	fucosyltransferase 11	Fut11	fucosyltransferase 11 (alpha (1,3) fucosyltransferase)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-19	Fut11	fucosyltransferase 11 (alpha (1,3) fucosyltransferase)	Fut11	fucosyltransferase 11	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-12-14	Fut11	fucosyltransferase 11		alpha3-fucosyltransferase 11	Name updated	1299863	APPROVED
2003-02-27	Fut11	alpha3-fucosyltransferase 11			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message