Advanced Search (OLGA)

Gene: Baalc (BAALC binder of MAP3K1 and KLF4) Rattus norvegicus

Analyze

Symbol:

Baalc

Name:

BAALC binder of MAP3K1 and KLF4

RGD ID:

628703

Description:

Predicted to be located in cytosol; nucleoplasm; and sarcoplasm. Predicted to be active in cytoplasm. Orthologous to human BAALC (BAALC binder of MAP3K1 and KLF4); INTERACTS WITH 17beta-estradiol 3-benzoate; 6-propyl-2-thiouracil; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

BAALC, MAP3K1 and KLF4 binding; brain and acute leukemia cytoplasmic protein; brain and acute leukemia, cytoplasmic

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	BAALC (BAALC binder of MAP3K1 and KLF4)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Baalc (brain and acute leukemia, cytoplasmic)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Baalc (BAALC binder of MAP3K1 and KLF4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	BAALC (BAALC binder of MAP3K1 and KLF4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	BAALC (BAALC binder of MAP3K1 and KLF4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Baalc (BAALC binder of MAP3K1 and KLF4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	BAALC (BAALC binder of MAP3K1 and KLF4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	BAALC (BAALC binder of MAP3K1 and KLF4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Baalc (BAALC binder of MAP3K1 and KLF4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Baalc (BAALC binder of MAP3K1 and KLF4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	POLG (DNA polymerase gamma, catalytic subunit)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Baalc (brain and acute leukemia, cytoplasmic)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	BAALC (BAALC binder of MAP3K1 and KLF4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:ch211-215i13.3	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	baalca	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	baalcb	Alliance	DIOPT (InParanoid\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	baalc	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	71,803,640 - 71,877,608 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	71,774,898 - 71,879,261 (+)	Ensembl				GRCr8
mRatBN7.2	7	69,918,998 - 69,992,289 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	69,918,998 - 69,992,288 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	71,791,475 - 71,864,968 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	73,994,057 - 74,067,554 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	73,862,086 - 73,935,579 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	7	73,831,905 - 73,905,199 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	7	74,689,420 - 74,762,759 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	7	74,828,498 - 74,901,837 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	7	73,449,251 - 73,522,491 (+)	NCBI		F344_StmMcwi
Rnor_6.0	7	77,761,056 - 77,836,534 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	77,763,512 - 77,837,453 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	78,415,169 - 78,491,960 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	74,426,267 - 74,499,551 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	66,975,936 - 67,049,177 (+)	NCBI		Celera
RGSC_v3.1	7	74,446,996 - 74,520,280 (+)	NCBI
Cytogenetic Map	7	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acute myeloid leukemia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (ISO)

17beta-estradiol 3-benzoate (EXP)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium atom (EXP)

cadmium dichloride (EXP)

carbamazepine (ISO)

carbon nanotube (ISO)

chlorpyrifos (EXP)

cocaine (ISO)

diarsenic trioxide (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

ethanol (ISO)

fenvalerate (EXP)

fulvestrant (ISO)

furan (EXP)

genistein (ISO)

iron dichloride (ISO)

lead(0) (ISO)

lipopolysaccharide (ISO)

methimazole (EXP)

methylmercury chloride (ISO)

Moniliformin (ISO)

paracetamol (EXP)

paraquat (EXP)

poly(I:C) (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

progesterone (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

temozolomide (ISO)

titanium dioxide (EXP)

trichostatin A (ISO)

triptonide (ISO)

uranium atom (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

cytoplasm (IBA,IEA,ISO)

cytosol (ISO)

membrane raft (IEA)

neuron projection (IEA)

postsynaptic density (IEA)

synapse (IEA)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	BAALC, the human member of a novel mammalian neuroectoderm gene lineage, is implicated in hematopoiesis and acute leukemia.	Tanner SM, etal., Proc Natl Acad Sci U S A 2001 Nov 20;98(24):13901-6.

Additional References at PubMed

PMID:15659234	PMID:15749074	PMID:16376586

Genomics

Comparative Map Data

Baalc
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	71,803,640 - 71,877,608 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	71,774,898 - 71,879,261 (+)	Ensembl				GRCr8
mRatBN7.2	7	69,918,998 - 69,992,289 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	69,918,998 - 69,992,288 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	71,791,475 - 71,864,968 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	73,994,057 - 74,067,554 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	73,862,086 - 73,935,579 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	7	73,831,905 - 73,905,199 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	7	74,689,420 - 74,762,759 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	7	74,828,498 - 74,901,837 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	7	73,449,251 - 73,522,491 (+)	NCBI		F344_StmMcwi
Rnor_6.0	7	77,761,056 - 77,836,534 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	77,763,512 - 77,837,453 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	78,415,169 - 78,491,960 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	74,426,267 - 74,499,551 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	66,975,936 - 67,049,177 (+)	NCBI		Celera
RGSC_v3.1	7	74,446,996 - 74,520,280 (+)	NCBI
Cytogenetic Map	7	q22	NCBI

BAALC
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	103,140,725 - 103,230,305 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	103,140,433 - 103,230,305 (+)	Ensembl			hg38	GRCh38
GRCh37	8	104,152,953 - 104,242,533 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	104,222,097 - 104,311,709 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	8	104,222,118 - 104,311,708	NCBI
Celera	8	100,339,760 - 100,429,361 (+)	NCBI		Celera
Cytogenetic Map	8	q22.3	NCBI
HuRef	8	99,353,733 - 99,443,786 (+)	NCBI		HuRef
CHM1_1	8	104,193,956 - 104,283,538 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	8	104,268,674 - 104,358,246 (+)	NCBI		T2T-CHM13v2.0

Baalc
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	38,739,763 - 38,814,659 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	38,740,784 - 38,816,307 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	15	38,933,909 - 38,951,264 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	38,933,144 - 38,952,912 (+)	Ensembl			mm10	GRCm38
MGSCv37	15	38,765,455 - 38,782,810 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	15	38,763,983 - 38,781,331 (+)	NCBI		MGSCv36	mm8
Celera	15	39,362,620 - 39,436,514 (+)	NCBI		Celera
Cytogenetic Map	15	B3.1	NCBI
cM Map	15	15.18	NCBI

Baalc
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955417	27,426,764 - 27,436,620 (+)	NCBI	ChiLan1.0	ChiLan1.0

BAALC
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	120,506,558 - 120,647,686 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	96,042,479 - 96,183,633 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	99,796,292 - 99,942,112 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	101,950,095 - 102,041,388 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	101,950,095 - 102,041,388 (+)	Ensembl			panPan2	panpan1.1

BAALC
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	13	4,602,688 - 4,684,138 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	13	4,603,020 - 4,682,189 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	13	4,580,567 - 4,687,615 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	13	4,740,979 - 4,848,073 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	13	4,767,073 - 4,848,070 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	13	4,581,689 - 4,688,798 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	13	4,699,133 - 4,806,795 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	13	4,712,208 - 4,819,394 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Baalc
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	33,080,068 - 33,154,084 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936470	40,508,338 - 40,579,585 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936470	40,506,596 - 40,590,537 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

BAALC
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	33,892,079 - 33,984,121 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	33,894,240 - 33,983,920 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	36,745,234 - 36,837,274 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

BAALC
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	98,001,547 - 98,082,381 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	98,001,432 - 98,082,132 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666039	42,517,088 - 42,599,377 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Baalc
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624763	19,801,172 - 19,835,724 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624763	19,801,144 - 19,838,313 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Baalc
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	212,234,153 - 212,334,016 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Baalc
306 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	84
Count of miRNA genes:	73
Interacting mature miRNAs:	77
Transcripts:	ENSRNOT00000006411
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10053722	Scort27	Serum corticosterone level QTL 27	2.41	0.0083	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	45113903	90113903	Rat
2317035	Aia16	Adjuvant induced arthritis QTL 16	2.71		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	7	71103011	106126789	Rat
1357336	Gluco6	Glucose level QTL 6	3.4		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	7	51700643	96700643	Rat
1300127	Srn1	Serum renin concentration QTL 1	3.87		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	7	24179478	86817926	Rat
1358361	Sradr5	Stress Responsive Adrenal Weight QTL 5	5.55		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	7	31770293	110435881	Rat
1298525	Cm1	Cardiac mass QTL 1	2.7		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	7	56625161	101625161	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	71621154	114982716	Rat
631513	Scl7	Serum cholesterol level QTL 7	4.1		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	39845902	84845902	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	46307490	127866166	Rat
10755453	Coatc12	Coat color QTL 12		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	32998702	77998702	Rat
1559283	Emca4	Estrogen-induced mammary cancer QTL 4	3.7		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	7	63889858	108889858	Rat
1300151	Bp181	Blood pressure QTL 181	3.36		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	7	55498584	105834451	Rat
7411605	Foco14	Food consumption QTL 14	24.1	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	36178764	81178764	Rat
738030	Anxrr8	Anxiety related response QTL 8	4.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	48475049	93475049	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	10112916	99900612	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	1	104117804	Rat
631534	Lnnr1	Liver neoplastic nodule remodeling QTL 1	3.85	0.001	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	7	36178764	81178764	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	1509236	116977875	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	40540077	123682549	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	49682832	115766396	Rat
1298528	Bp169	Blood pressure QTL 169		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	62963207	107963207	Rat
1576303	Ept7	Estrogen-induced pituitary tumorigenesis QTL 7	3.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	7	63889858	108889858	Rat
1300132	Bp182	Blood pressure QTL 182	3.49		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	21541977	86817926	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	49682832	115766396	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	49682832	115766396	Rat
2303582	Gluco53	Glucose level QTL 53	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	7	48603087	93603087	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	71621154	119349044	Rat
61439	Cia8	Collagen induced arthritis QTL 8	5.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	7	27182914	72182914	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	71827901	136544683	Rat

Markers in Region

BE111446

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	69,990,931 - 69,991,085 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	77,835,177 - 77,835,330	NCBI	Rnor6.0
Rnor_5.0	7	78,416,790 - 78,416,943	UniSTS	Rnor5.0
RGSC_v3.4	7	74,498,194 - 74,498,347	UniSTS	RGSC3.4
Celera	7	67,047,820 - 67,047,973	UniSTS
RH 3.4 Map	7	630.6	UniSTS
Cytogenetic Map	7	q22	UniSTS

RH134683

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	69,992,052 - 69,992,232 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	77,836,298 - 77,836,477	NCBI	Rnor6.0
Rnor_5.0	7	78,415,643 - 78,415,822	UniSTS	Rnor5.0
RGSC_v3.4	7	74,499,315 - 74,499,494	UniSTS	RGSC3.4
Celera	7	67,048,941 - 67,049,120	UniSTS
RH 3.4 Map	7	630.4	UniSTS
Cytogenetic Map	7	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
12	11	65	158	64	63	32	38	32	6	266	136	10	137	79	92	31	14	14

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_144762	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017594632	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063262929	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB073318	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC126589	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF371321	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF371325	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000006411 ⟹ ENSRNOP00000006411

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	71,804,043 - 71,877,601 (+)	Ensembl
mRatBN7.2 Ensembl	7	69,918,998 - 69,992,288 (+)	Ensembl
Rnor_6.0 Ensembl	7	77,763,512 - 77,837,453 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000127989 ⟹ ENSRNOP00000107827

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	71,804,005 - 71,879,261 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000150894 ⟹ ENSRNOP00000110037

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	71,774,898 - 71,879,261 (+)	Ensembl

RefSeq Acc Id:

NM_144762 ⟹ NP_658907

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	71,803,901 - 71,877,191 (+)	NCBI
mRatBN7.2	7	69,918,998 - 69,992,289 (+)	NCBI
Dahl_SR_JrHsd	7	73,831,905 - 73,905,199 (+)	NCBI
Lyon_Normotensive	7	74,689,420 - 74,762,759 (+)	NCBI
Lyon_Hypertensive	7	74,828,498 - 74,901,837 (+)	NCBI
F344_StmMcwi	7	73,449,251 - 73,522,491 (+)	NCBI
Rnor_6.0	7	77,763,246 - 77,836,534 (+)	NCBI
Rnor_5.0	7	78,415,169 - 78,491,960 (-)	NCBI
RGSC_v3.4	7	74,426,267 - 74,499,551 (+)	RGD
Celera	7	66,975,936 - 67,049,177 (+)	RGD

Sequence:

show sequence

ACTCTGTAGCACAGCCTCTGCGAGAACAGTTAAGGAGGGACTGGCGGCTGGGCGGTGGGAGAGG
CGAGGTAGAGGGGAGCTGGGGAAGGAGAGCGGAGAGGAGGAGGGCCTTGGAGGCAGAGAGGAGG
GGCGGCAGGTTCCCGGGGAGCCTGGCGCTGGCAGCGGCTCTGGCGGTTAGGGGACCGATGTCGT
GCCGCCGCCTCCTCCTCGAGGGCCGGAGCTGCGTCGCCCGGGCTGAGCCGCAGCCGCAGCCGCA
AGCCGAACGGCCGCCGGGCGCGCCCGCAACAGGAGAGGATGGGCTGCGGCGGGAGCCGAGCCGA
TGCCATCGAGCCCCGCTACTATGAGAGCTGGACCCGGGAGACCGAGTCCACCTGGCTCACCTAC
ACCGACTCGGACGCGCTGCCCAGCGCCGCAGCCACGGACAGCGGCCCCGAGGCGGGCGGCCTGC
ACGCGGGTGTGCTGGAAGACGGGCCGTCCTCTAACGGTGTGCTCCGACCTGCAGCCCCAGGTGG
AATAGCCAACCCAGAGAAGAAGATGAACTGTGGGACCCAATGTCCCAACTCACAGAGCCTCAGC
TCAGGCCCTCTGACCCAGAAGCAGAATGGCCTTTGGACCACAGAGGCTAAAAGGGATGCCAAGC
GAATGTCTGCAAGAGAAGTCGCTATCAGCGTCACAGAGAATATCCGGCAGATGGACAGAAGTAA
AAGGGTCACAAAGAACTGCATCAATTAGCAGCGTCTGGGTGTGGAAGCACATGAACTTCTTTGT
GGCGTCCAGTCAAAGAATATTGAAGAAGTGGGTGTCACTCACTGAACGTGGATGCCTCTGAGCG
ACGCACGGCCACCCACGCGGTGACGACCATCCCGGGTTTCCTGTTTATCACATACAGAAAATAC
ATCSGAAAGTCCTGGAATATGTCACAGATTGCCAAACTATGGTTTGTTTTTCCTCTCTGCAGCT
TCCGTAGCAGGGTCTGCTGTAACCATGGTGAAGCCCGTGGGCCTGTGAATGAATATTGGAATCC
CCGGGGCAAGGAGTCACGCTAGCGTAGAAATTTCACAGTGCGTGGTTTCGGACAAGCTCCCTTT
TCCTCCTTTCTTTTAAATACGGCCATTGTTTTCACTTAAGAGCTGGCTCTCACCAACTCTAAAC
TCAAAAATACAAGAATCAGAGAAACAGGGAGACTCAGAATGAGATCCATTAGTCCTAGCTTCAC
GTGCTGACTCCCCGGTGCCTATGCGGTGCCTTTAGGAGGTGTCTATGACACACACACACACACA
CACACACACACACACACACACACACCTGTTCCTCCTCTACCTGGAAAGGTCTCCCAGGCTGGCA
TCAGGCATTGGCTTCCGAATCACAATGTTCACATGTTTGGGGCCCTTGCACCCAACCTGCACCC
GCTTTGGGACCTAGCTCCATGTGGCTTTTCCCATAGCTTTCTAGTTCCCTGTTCTTCTCATGGA
CTTTGTACTCCAGTCAGGTCATTTGCAGCTGTAATCAAAGACTGGACACCACTCCCGGGGGAAG
GTGACCTAGGAACACATGGTGACACACACGATGCCCCCTTGGCCTTTCTGTACACAGCCCCAAG
GACCGTGTTATTTTGGTATCTGCAAAGCAATTAGTTTGGAAAGCCAGANCCTGGTTGATGTTAT
ATTCCCTGCTGACATCAGGACCAAGGAAGGGCACTGTATTGGAAAGCAGGCGGCCAACACAGCC
AAGCCATGNTCTGATAGGGACCATTTTCCCACATTCCTAAACACATCCTCCTGCAAAGTATGGC
ACAGCCTGAGTTTGAAAGGACCGTTCACTTGCTTGGGCTTATTAAAGGTATAGTCCAAGTTGTG
TCAAACTGTATCAACAGACTCCACATCTAGCAGCAAGAGCAGTCTGGTGACATGTTTATACGAC
ACAGTCCAAGAGAAGTAACCTAAGCGGGCTAAAATGCAGATGCTCACGCCTGTCTCTGAAGTGA
TTCCTCCAACACAGACAGAACTGTAAACTGTGCGTTTATTCGTATTAAAATTCACTGCCAATCT
TGTGCCAGCTACAGTAACAGACACAGAGGGGGTTGGAGTCTGGCAGTCACGACCGTACATCTGA
CTCTATGGGGAGGCTTGAGACTCAGGAGAATGACCTGAACCCTGCGGCACAGGACCAACCATTG
CAGTGGAATCTCACTTCTAGGTTAAAGGTAGCTTTCTATCCATCGCAAATGTATGTCTTCTCCT
CTGCCGTGTAGACTACAGTTTTCCCCAACCTCTCTCACCTTGACTCCTTGTCAAAGGGCTTTTA
GGGAACTTCATGTTCTGACAATTTAACTAATAAAACAAAAGCAAGCCCCGTGAAAAAAAAAAAA
A

hide sequence

RefSeq Acc Id:

XM_063262929 ⟹ XP_063118999

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	71,803,640 - 71,877,608 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_658907	(Get FASTA)	NCBI Sequence Viewer
	XP_063118999	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAL50517	(Get FASTA)	NCBI Sequence Viewer
	AAL50521	(Get FASTA)	NCBI Sequence Viewer
	BAB70507	(Get FASTA)	NCBI Sequence Viewer
	EDM16358	(Get FASTA)	NCBI Sequence Viewer
	EDM16359	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000006411
	ENSRNOP00000006411.4
	ENSRNOP00000107827
GenBank Protein	Q920K5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_658907 ⟸ NM_144762
- UniProtKB:	Q790N3 (UniProtKB/Swiss-Prot), Q920K5 (UniProtKB/Swiss-Prot), A6HR63 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGCGGSRADAIEPRYYESWTRETESTWLTYTDSDALPSAAATDSGPEAGGLHAGVLEDGPSSNG VLRPAAPGGIANPEKKMNCGTQCPNSQSLSSGPLTQKQNGLWTTEAKRDAKRMSAREVAISVTE NIRQMDRSKRVTKNCIN hide sequence

Ensembl Acc Id:

ENSRNOP00000006411 ⟸ ENSRNOT00000006411

RefSeq Acc Id:	XP_063118999 ⟸ XM_063262929
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000107827 ⟸ ENSRNOT00000127989

Ensembl Acc Id:

ENSRNOP00000110037 ⟸ ENSRNOT00000150894

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q920K5-F1-model_v2	AlphaFold	Q920K5	1-145	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:628703	AgrOrtholog
BioCyc Gene	G2FUF-33580	BioCyc
Ensembl Genes	ENSRNOG00000004697	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000006411	ENTREZGENE
	ENSRNOT00000006411.7	UniProtKB/Swiss-Prot
	ENSRNOT00000127989	ENTREZGENE
InterPro	BAALC	UniProtKB/Swiss-Prot
KEGG Report	rno:140720	UniProtKB/Swiss-Prot
NCBI Gene	140720	ENTREZGENE
PANTHER	BRAIN AND ACUTE LEUKEMIA CYTOPLASMIC PROTEIN	UniProtKB/Swiss-Prot
	PTHR14731	UniProtKB/Swiss-Prot
Pfam	BAALC_N	UniProtKB/Swiss-Prot
PhenoGen	Baalc	PhenoGen
RatGTEx	ENSRNOG00000004697	RatGTEx
UniProt	A0ABK0M470_RAT	UniProtKB/TrEMBL
	A6HR63	ENTREZGENE, UniProtKB/TrEMBL
	A6HR64_RAT	UniProtKB/TrEMBL
	BAALC_RAT	UniProtKB/Swiss-Prot
	Q790N3	ENTREZGENE
	Q920K5	ENTREZGENE
UniProt Secondary	Q790N3	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-03-26	Baalc	BAALC binder of MAP3K1 and KLF4	Baalc	BAALC, MAP3K1 and KLF4 binding	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2017-05-18	Baalc	BAALC, MAP3K1 and KLF4 binding	Baalc	brain and acute leukemia, cytoplasmic	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-02-26	Baalc	brain and acute leukemia, cytoplasmic			Symbol and Name status set to approved	625702	APPROVED
2003-02-27	Baalc	brain and acute leukemia, cytoplasmic			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_disease	overexpressed in patients with acute leukemia	632264

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD