Advanced Search (OLGA)

Gene: Gpr3 (G protein-coupled receptor 3) Rattus norvegicus

Analyze

Symbol:

Gpr3

Name:

G protein-coupled receptor 3

RGD ID:

628686

Description:

Predicted to enable sphingosine-1-phosphate receptor activity. Involved in positive regulation of cAMP/PKA signal transduction and regulation of cytosolic calcium ion concentration. Predicted to be located in nuclear membrane. Predicted to be active in cytoplasm and plasma membrane. Orthologous to human GPR3 (G protein-coupled receptor 3); INTERACTS WITH 2,3,7,8-Tetrachlorodibenzofuran; acrolein; acrylamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

G protein-coupled receptor R4; G-protein coupled receptor 3; G-protein-coupled receptor R4; Gpcr3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GPR3 (G protein-coupled receptor 3)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):	Gpr3 (G-protein coupled receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gpr3 (G protein-coupled receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GPR3 (G protein-coupled receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GPR3 (G protein-coupled receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gpr3 (G protein-coupled receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GPR3 (G protein-coupled receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GPR3 (G protein-coupled receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gpr3 (G protein-coupled receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	GPR3 (G protein-coupled receptor 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gpr3 (G-protein coupled receptor 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gpr186 (G protein-coupled receptor 186)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	150,695,406 - 150,698,526 (-)	NCBI		GRCr8
mRatBN7.2	5	145,411,500 - 145,414,621 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	145,411,510 - 145,414,590 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	148,114,948 - 148,118,071 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	149,884,543 - 149,887,666 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	149,869,432 - 149,872,552 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	151,394,118 - 151,397,634 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	151,394,524 - 151,397,603 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	155,060,168 - 155,063,449 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	151,915,723 - 151,916,688 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	151,925,761 - 151,926,727 (+)	NCBI
Celera	5	143,834,248 - 143,835,213 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2-hydroxypropanoic acid (ISO)

2-palmitoylglycerol (ISO)

acrolein (EXP)

acrylamide (EXP)

actinomycin D (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Butylbenzyl phthalate (ISO)

C60 fullerene (EXP)

cadmium dichloride (ISO)

camptothecin (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

cocaine (EXP)

dibutyl phthalate (ISO)

dicrotophos (ISO)

diethyl phthalate (ISO)

diisobutyl phthalate (ISO)

diisononyl phthalate (ISO)

ethanol (ISO)

flavonoids (EXP)

formaldehyde (ISO)

furan (EXP)

genistein (EXP)

gentamycin (EXP)

iron dichloride (ISO)

leflunomide (ISO)

methylisothiazolinone (ISO)

N-methyl-4-phenylpyridinium (ISO)

Nutlin-3 (ISO)

phorbol 13-acetate 12-myristate (ISO)

pirinixic acid (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

sodium arsenite (ISO)

sulforaphane (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

tris(2-butoxyethyl) phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-activating G protein-coupled receptor signaling pathway (IBA,ISO)

G protein-coupled receptor signaling pathway (IEA)

G protein-coupled receptor signaling pathway coupled to cGMP nucleotide second messenger (ISO)

negative regulation of cell cycle (ISO)

negative regulation of cell population proliferation (ISO)

negative regulation of meiotic cell cycle process involved in oocyte maturation (ISO)

negative regulation of oocyte maturation (ISO)

positive regulation of cAMP/PKA signal transduction (IDA)

positive regulation of cold-induced thermogenesis (ISO,ISS)

regulation of cytosolic calcium ion concentration (IDA)

regulation of meiotic nuclear division (IEA,ISO)

regulation of metabolic process (IBA)

sphingosine-1-phosphate receptor signaling pathway (IEA)

Cellular Component

cytoplasm (IBA,ISO)

nuclear membrane (ISO)

plasma membrane (IBA,IEA,ISO)

Molecular Function

G protein-coupled receptor activity (IEA)

protein binding (ISO)

sphingosine-1-phosphate receptor activity (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Mice lacking GPR3 receptors display late-onset obese phenotype due to impaired thermogenic function in brown adipose tissue.	Godlewski G, etal., Sci Rep. 2015 Oct 12;5:14953. doi: 10.1038/srep14953.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Sphingosine 1-phosphate is a ligand of the human gpr3, gpr6 and gpr12 family of constitutively active G protein-coupled receptors.	Uhlenbrock K, etal., Cell Signal 2002 Nov;14(11):941-53.

Additional References at PubMed

PMID:7698767	PMID:15591206	PMID:16229830	PMID:22498817	PMID:22685609	PMID:24769160	PMID:34871769

Genomics

Comparative Map Data

Gpr3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	150,695,406 - 150,698,526 (-)	NCBI		GRCr8
mRatBN7.2	5	145,411,500 - 145,414,621 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	145,411,510 - 145,414,590 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	148,114,948 - 148,118,071 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	149,884,543 - 149,887,666 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	149,869,432 - 149,872,552 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	151,394,118 - 151,397,634 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	151,394,524 - 151,397,603 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	155,060,168 - 155,063,449 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	151,915,723 - 151,916,688 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	151,925,761 - 151,926,727 (+)	NCBI
Celera	5	143,834,248 - 143,835,213 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

GPR3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	27,392,622 - 27,395,814 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	27,392,622 - 27,395,814 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	27,719,126 - 27,722,318 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	27,591,739 - 27,594,905 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	27,403,293 - 27,406,457	NCBI
Celera	1	26,116,440 - 26,119,606 (+)	NCBI		Celera
Cytogenetic Map	1	p36.11	NCBI
HuRef	1	25,975,292 - 25,978,462 (+)	NCBI		HuRef
CHM1_1	1	27,833,894 - 27,837,064 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	27,233,946 - 27,237,138 (+)	NCBI		T2T-CHM13v2.0

Gpr3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	132,936,651 - 132,939,847 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	132,936,651 - 132,939,847 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	133,209,340 - 133,212,536 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	133,209,340 - 133,212,536 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	132,765,255 - 132,768,451 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	132,481,416 - 132,484,583 (-)	NCBI		MGSCv36	mm8
Celera	4	131,374,420 - 131,377,613 (-)	NCBI		Celera
Cytogenetic Map	4	D2.3	NCBI
cM Map	4	66.24	NCBI

Gpr3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955452	6,648,470 - 6,651,389 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955452	6,648,470 - 6,651,938 (+)	NCBI	ChiLan1.0	ChiLan1.0

GPR3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	199,456,334 - 199,463,539 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	198,571,094 - 198,578,075 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	26,654,198 - 26,657,421 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	27,702,003 - 27,705,195 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	27,703,180 - 27,704,172 (+)	Ensembl	panpan1.1		panPan2

GPR3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	72,882,127 - 72,885,369 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	72,883,183 - 72,884,175 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	69,459,125 - 69,462,341 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	73,443,788 - 73,447,004 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	73,444,818 - 73,445,810 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	70,269,792 - 70,273,006 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	71,281,278 - 71,284,494 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	72,277,315 - 72,280,532 (-)	NCBI		UU_Cfam_GSD_1.0

Gpr3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	45,873,901 - 45,877,167 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	11,698,764 - 11,701,201 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	11,699,725 - 11,701,311 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GPR3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	84,610,107 - 84,613,202 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	84,610,107 - 84,613,202 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	78,180,803 - 78,184,402 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GPR3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	105,395,207 - 105,398,352 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	105,396,228 - 105,397,220 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	11,060,423 - 11,063,756 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gpr3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624764	11,282,994 - 11,283,986 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624764	11,281,833 - 11,292,573 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Gpr3
10 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	47
Count of miRNA genes:	44
Interacting mature miRNAs:	46
Transcripts:	ENSRNOT00000012710
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	97059760	147465714	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
2302369	Scl60	Serum cholesterol level QTL 60	3.13		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	143608201	161165651	Rat
631562	Apr2	Acute phase response QTL 2	3.7		blood murinoglobulin 1 amount (VT:0010597)	plasma murinoglobulin 1 level (CMO:0001931)	5	135927956	166875058	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	135929696	166875058	Rat
1300119	Bp180	Blood pressure QTL 180	3.82		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	144358090	157869054	Rat
70156	Niddm30	Non-insulin dependent diabetes mellitus QTL 30	3.98		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	5	129132447	151006154	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	106906205	151906205	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	106906205	151906205	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
631263	Cm24	Cardiac mass QTL 24	3.5		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	143799107	158428037	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	132717196	165560427	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	106906205	151906205	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	143069996	166846814	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	105999803	150999803	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	120740824	151018848	Rat
1578673	Bmd13	Bone mineral density QTL 13	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	5	103689353	148689353	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
2313096	Bmd78	Bone mineral density QTL 78	3.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	5	144377876	161317411	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	106906205	151906205	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	106906205	151906205	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	99216724	148607142	Rat

Markers in Region

Gpcr12

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	145,412,205 - 145,412,432 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	151,395,220 - 151,395,446	NCBI	Rnor6.0
Rnor_5.0	5	155,061,041 - 155,061,267	UniSTS	Rnor5.0
RGSC_v3.4	5	151,916,784 - 151,917,010	UniSTS	RGSC3.4
Celera	5	143,833,926 - 143,834,152	UniSTS
Cytogenetic Map	5	q36	UniSTS

UniSTS:494981

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	145,412,289 - 145,413,897 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	151,395,304 - 151,396,910	NCBI	Rnor6.0
Rnor_5.0	5	155,061,125 - 155,062,731	UniSTS	Rnor5.0
RGSC_v3.4	5	151,915,320 - 151,916,926	UniSTS	RGSC3.4
Celera	5	143,834,010 - 143,835,616	UniSTS
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
8	2	37	104	29	31	11	10	11	5	108	56	93	33	56	20

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_153727	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006239006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AJ427482	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L32829	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000012710 ⟹ ENSRNOP00000068107

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	5	151,395,542 - 151,396,507 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076866 ⟹ ENSRNOP00000068417

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	145,411,510 - 145,414,590 (-)	Ensembl
Rnor_6.0 Ensembl	5	151,394,524 - 151,397,603 (-)	Ensembl

RefSeq Acc Id:

NM_153727 ⟹ NP_714949

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	150,695,406 - 150,698,526 (-)	NCBI
mRatBN7.2	5	145,411,500 - 145,414,621 (-)	NCBI
Rnor_6.0	5	151,395,542 - 151,396,507 (-)	NCBI
Rnor_5.0	5	155,060,168 - 155,063,449 (-)	NCBI
RGSC_v3.4	5	151,915,723 - 151,916,688 (+)	RGD
Celera	5	143,834,248 - 143,835,213 (-)	RGD

Sequence:

show sequence

ATGGCCTGGTTCTCAGCCGGCTCAGGCAGTGTGAATGTGAGCATAGACCCAGCAGAGGAACCTA
CAGGCCCAGCTACACTGCTGCCCTCTCCCAGGGCCTGGGATGTGGTGCTGTGCATCTCAGGCAC
CCTGGTGTCCTGCGAGAATGCTCTGGTGRTGGCCATCATTGTGGGCACGCCTGCCTTCCGCGCC
CCCATGTTCCTGCTGGTGGGCAGCTTGGCCGTAGCAGACCTGCTGGCAGGCCTGGGCCTGGTCC
TGCACTTCGCTGCTGACTTCTGTATTGGCTCACCAGAGATGAGCTTGGTGCTGGTTGGCGTGCT
AGCAACGGCCTTTACTGCCAGCATCGGCAGCCTGCTGGCCATCACCGTTGACCGCTACCTTTCC
CTGTACAACGCCCTCACCTACTACTCAGAGACAACAGTAACTCGAACCTACGTGATGCTGGCCT
TGGTGTGGGTGGGTGCCCTGGGCCTGGGGCTGGTTCCCGTGCTGGCCTGGAACTGCCGGGATGG
CCTGACCACGTGCGGCGTAGTCTATCCACTCTCCAAGAACCATCTGGTGGTTCTGGCCATCGTC
TTCTTCATGGTGTTTGGCATCATGCTACAAGCTCTATGCCCAGATCTGCCGCATTGTTTGCCGC
CACGGCCCAAGCAGATCGCCCTCCAACGACACCTGCTGCCTGCCTCCCACTACGTGGCCACCCG
CAAGGGCATCGCCACATTGGCCGTGGTGCTTGGCGCCTTTGCCGCCTGTTGGTTGCCCTTCACT
GTCTACTGCCTCCTGGGAGACGCCAACTCTCCTCCTCTCTACACCTACCTTACCCTGCTCCCTG
CCACTTACAACTCCATGATCAACCCGGTCATTTACGCCTTCCGCAACCAAGACGTGCAGAAGGT
GCTGTGGGCCATCTGCTGCTGCTGTTCTACTTCCAAGATCCCATTCCGGTCCCGGTCCCCTAGT
GATGTCTAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_714949	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA73559	(Get FASTA)	NCBI Sequence Viewer
	CAD20634	(Get FASTA)	NCBI Sequence Viewer
	EDL80660	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000068417
	ENSRNOP00000068417.2
GenBank Protein	Q8K1Q3	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_714949 ⟸ NM_153727

- UniProtKB:

Q8K1Q3 (UniProtKB/Swiss-Prot), Q63230 (UniProtKB/Swiss-Prot), A0A096MK84 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAWFSAGSGSVNVSIDPAEEPTGPATLLPSPRAWDVVLCISGTLVSCENALVXAIIVGTPAFRA
PMFLLVGSLAVADLLAGLGLVLHFAADFCIGSPEMSLVLVGVLATAFTASIGSLLAITVDRYLS
LYNALTYYSETTVTRTYVMLALVWVGALGLGLVPVLAWNCRDGLTTCGVVYPLSKNHLVVLAIV
FFMVFGIMLQALCPDLPHCLPPRPKQIALQRHLLPASHYVATRKGIATLAVVLGAFAACWLPFT
VYCLLGDANSPPLYTYLTLLPATYNSMINPVIYAFRNQDVQKVLWAICCCCSTSKIPFRSRSPS
DV

hide sequence

Ensembl Acc Id:

ENSRNOP00000068107 ⟸ ENSRNOT00000012710

Ensembl Acc Id:

ENSRNOP00000068417 ⟸ ENSRNOT00000076866

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8K1Q3-F1-model_v2	AlphaFold	Q8K1Q3	1-329	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:628686	AgrOrtholog
BioCyc Gene	G2FUF-39641	BioCyc
Ensembl Genes	ENSRNOG00000009540	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000076866	UniProtKB/TrEMBL
	ENSRNOT00000076866.2	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPR3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPR_3/6/12_orphan	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:266769	UniProtKB/Swiss-Prot
NCBI Gene	266769	ENTREZGENE
PANTHER	G-PROTEIN COUPLED RECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	7tm_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Gpr3	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPR3ORPHANR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPRORPHANR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000009540	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A096MK84	ENTREZGENE, UniProtKB/TrEMBL
	GPR3_RAT	UniProtKB/Swiss-Prot
	Q63230	ENTREZGENE
	Q8K1Q3	ENTREZGENE
UniProt Secondary	Q63230	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-01-20	Gpr3	G protein-coupled receptor 3	Gpcr3	G-protein coupled receptor 3	Symbol and Name updated	1299863	APPROVED
2003-02-27	Gpcr3	G-protein coupled receptor 3			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message