Advanced Search (OLGA)

Gene: Gbx1 (gastrulation brain homeobox 1) Rattus norvegicus

Analyze

Symbol:

Gbx1

Name:

gastrulation brain homeobox 1

RGD ID:

621864

Description:

Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II transcription regulatory region sequence-specific DNA binding activity. Predicted to be involved in regulation of nervous system development and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within adult walking behavior; neuron differentiation; and proprioception. Predicted to be active in nucleus. Orthologous to human GBX1 (gastrulation brain homeobox 1); INTERACTS WITH bisphenol A; Butylbenzyl phthalate; glyphosate.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

gastrulation brain homeo box 1; homeobox protein GBX-1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GBX1 (gastrulation brain homeobox 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Gbx1 (gastrulation brain homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gbx1 (gastrulation brain homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GBX1 (gastrulation brain homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GBX1 (gastrulation brain homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gbx1 (gastrulation brain homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GBX1 (gastrulation brain homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GBX1 (gastrulation brain homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gbx1 (gastrulation brain homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Gbx1 (gastrulation brain homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	GBX1 (gastrulation brain homeobox 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gbx1 (gastrulation brain homeobox 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gbx1 (gastrulation brain homeobox 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	unpg	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	unpg	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	11,538,402 - 11,564,931 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	11,538,402 - 11,564,931 (+)	Ensembl				GRCr8
mRatBN7.2	4	10,645,957 - 10,672,486 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	10,645,957 - 10,672,486 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	15,792,089 - 15,818,580 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	11,612,280 - 11,638,772 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	9,964,062 - 9,990,554 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	7,173,961 - 7,200,752 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	7,173,961 - 7,200,752 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	7,186,479 - 7,212,119 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	6,025,962 - 6,036,534 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	6,262,522 - 6,287,235 (+)	NCBI		Celera
RGSC_v3.1	4	6,036,248 - 6,036,363 (+)	NCBI
Cytogenetic Map	4	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

long QT syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dichloroethane (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4,4'-trichlorobiphenyl (ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

Butylbenzyl phthalate (EXP)

chlorpyrifos (ISO)

glyphosate (EXP)

lipopolysaccharide (ISO)

mono(2-ethylhexyl) phthalate (ISO)

okadaic acid (ISO)

paracetamol (EXP)

PCB138 (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

testosterone (EXP)

trichloroethene (EXP)

triclosan (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adult walking behavior (ISO)

neuron fate commitment (ISO)

proprioception (ISO)

regulation of DNA-templated transcription (IEA)

regulation of nervous system development (IBA)

regulation of transcription by RNA polymerase II (IBA)

sensory neuron axon guidance (ISO)

spinal cord motor neuron differentiation (ISO)

Cellular Component

nucleus (IBA,IEA,ISO)

Molecular Function

DNA binding (IEA)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IEA)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	The homeobox genes Lhx7 and Gbx1 are expressed in the basal forebrain cholinergic system.	Asbreuk CH, etal., Neuroscience 2002;109(2):287-98.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Isolation and expression of the homeobox gene Gbx1 during mouse development.	Rhinn M, etal., Dev Dyn 2004 Feb;229(2):334-9.

Additional References at PubMed

PMID:22252490	PMID:23418536	PMID:24010020

Genomics

Comparative Map Data

Gbx1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	11,538,402 - 11,564,931 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	11,538,402 - 11,564,931 (+)	Ensembl				GRCr8
mRatBN7.2	4	10,645,957 - 10,672,486 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	10,645,957 - 10,672,486 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	15,792,089 - 15,818,580 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	11,612,280 - 11,638,772 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	9,964,062 - 9,990,554 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	7,173,961 - 7,200,752 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	7,173,961 - 7,200,752 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	7,186,479 - 7,212,119 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	6,025,962 - 6,036,534 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	6,262,522 - 6,287,235 (+)	NCBI		Celera
RGSC_v3.1	4	6,036,248 - 6,036,363 (+)	NCBI
Cytogenetic Map	4	q11	NCBI

GBX1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	151,148,009 - 151,167,694 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	151,148,009 - 151,174,745 (-)	Ensembl			hg38	GRCh38
GRCh37	7	150,845,096 - 150,864,781 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	150,476,609 - 150,495,800 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	7	145,403,014 - 145,422,208 (-)	NCBI		Celera
Cytogenetic Map	7	q36.1	NCBI
HuRef	7	144,657,212 - 144,676,250 (-)	NCBI		HuRef
CHM1_1	7	150,854,052 - 150,873,263 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	152,321,091 - 152,340,783 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	150,175,196 - 150,194,388 (-)	NCBI

Gbx1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	24,709,424 - 24,731,846 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	24,707,755 - 24,732,200 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	24,504,426 - 24,526,848 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	24,502,757 - 24,527,202 (-)	Ensembl			mm10	GRCm38
MGSCv37	5	24,010,244 - 24,032,666 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	24,014,491 - 24,036,913 (-)	NCBI		MGSCv36	mm8
Celera	5	21,454,400 - 21,476,977 (-)	NCBI		Celera
Cytogenetic Map	5	A3	NCBI
cM Map	5	11.93	NCBI

Gbx1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955491	5,575,836 - 5,592,804 (-)	NCBI	ChiLan1.0	ChiLan1.0

GBX1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	187,566,475 - 187,589,538 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	39,576,740 - 39,599,804 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	142,733,463 - 142,754,447 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	154,887,871 - 154,914,165 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	154,888,479 - 154,907,060 (-)	Ensembl			panPan2	panpan1.1

GBX1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	16	15,195,705 - 15,213,425 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	16	15,803,468 - 15,821,434 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	16	16,917,670 - 16,935,631 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	16	16,918,432 - 16,936,366 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	16	15,289,827 - 15,307,782 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	16	15,871,255 - 15,889,408 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	16	15,922,115 - 15,940,079 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gbx1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	6,321,299 - 6,339,067 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936527	6,566,306 - 6,582,130 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936527	6,566,306 - 6,582,130 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GBX1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	6,058,730 - 6,080,906 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	18	6,058,888 - 6,080,908 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	6,422,775 - 6,445,608 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GBX1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	119,331,203 - 119,354,622 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666072	15,302,028 - 15,322,785 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gbx1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624800	5,464,792 - 5,484,670 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Gbx1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	6	153,700,487 - 153,724,998 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Gbx1
96 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	114
Count of miRNA genes:	96
Interacting mature miRNAs:	101
Transcripts:	ENSRNOT00000017854
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
8552903	Pigfal2	Plasma insulin-like growth factor 1 level QTL 2	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	1	32668025	Rat
724557	Plsm1	Polydactyly-luxate syndrome (PLS) morphotypes QTL 1		0.0003	forelimb integrity trait (VT:0010562)	front foot phalanges count (CMO:0001947)	4	1	28392287	Rat
9590100	Sffal4	Serum free fatty acids level QTL 4	7.36	0.05	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	4	1	32668025	Rat
8552906	Pigfal3	Plasma insulin-like growth factor 1 level QTL 3			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	11038706	56038706	Rat
1357341	Gluco5	Glucose level QTL 5	6.4		adipocyte free fatty acid secretion trait (VT:0010465)	absolute change in adipocyte free fatty acid secretion per unit volume (CMO:0001446)	4	1	34142783	Rat
1357343	Gluco4	Glucose level QTL 4		0.00002	adipocyte glucose uptake trait (VT:0004185)	adipocyte maximal glucose uptake to basal glucose uptake ratio (CMO:0000874)	4	1	34142783	Rat
8552782	Vie1	Viral induced encephalitis QTL 1	26.4		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	1	35396961	Rat
6478766	Anxrr47	Anxiety related response QTL 47		0.09637	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	11038706	56038706	Rat
631642	Stl2	Serum triglyceride level QTL 2	3.3		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5894575	57613242	Rat
6478769	Anxrr48	Anxiety related response QTL 48		0.02514	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	11038706	56038706	Rat
61333	Gluco16	Glucose level QTL 16	4.3	0.00001	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	1	31106810	Rat
61408	Scl23	Serum cholesterol level QTL 23		0.0005	blood HDL phospholipid amount (VT:0010504)	serum high density lipoprotein phospholipid level (CMO:0001567)	4	1	28392287	Rat
631209	Bw2	Body weight QTL2	4.2		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	1	45429897	Rat
8552803	Bw144	Body weight QTL 144	16		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	4	1	35396961	Rat
8694374	Bw155	Body weight QTL 155	3.39	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	4	11038706	56038706	Rat
8552801	Bw143	Body weight QTL 143	7.3		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	4	1	35396961	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5889999	148002343	Rat
9589046	Scfw2	Subcutaneous fat weight QTL 2	5.54	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	4	1	32668025	Rat
6478724	Anxrr35	Anxiety related response QTL 35		0.00449	defecation behavior trait (VT:0010462)	defecation measurement (CMO:0000997)	4	11038706	56038706	Rat
61351	Bp33	Blood pressure QTL 33		0.0018	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	1	28392287	Rat
61415	Eae11	Experimental allergic encephalomyelitis QTL 11	2.9		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	4	1	40471598	Rat
1641905	Colcr1	Colorectal carcinoma resistance QTL 1	4.3	0.0003	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	4	8428551	30449094	Rat
619616	Bp79	Blood pressure QTL 79		0.0292	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	5889999	50889999	Rat
8552809	Vie5	Viral induced encephalitis QTL 5	25.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	1	35396961	Rat
738021	Hcar13	Hepatocarcinoma resistance QTL 13	4.3		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	4	1	33538816	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	4	1	63900697	Rat
9590304	Scort17	Serum corticosterone level QTL 17	4.96	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	11038706	56038706	Rat
9589097	Slep11	Serum leptin concentration QTL 11	5.09	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	4	1	32668025	Rat
1300141	Bp178	Blood pressure QTL 178			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	10758701	40490708	Rat

Markers in Region

AU048731

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	10,657,130 - 10,657,418 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	7,185,135 - 7,185,422	NCBI	Rnor6.0
Rnor_5.0	4	7,197,653 - 7,197,940	UniSTS	Rnor5.0
Celera	4	6,272,826 - 6,273,143	UniSTS
Cytogenetic Map	4	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
6	2	3	92	16	14	3	13	3	1	45	24	87	11	38	11	3	3

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001271453	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC099360	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF219999	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000017854 ⟹ ENSRNOP00000017854

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	11,538,402 - 11,564,931 (+)	Ensembl
mRatBN7.2 Ensembl	4	10,645,957 - 10,672,486 (+)	Ensembl
Rnor_6.0 Ensembl	4	7,173,961 - 7,200,752 (+)	Ensembl

RefSeq Acc Id:

NM_001271453 ⟹ NP_001258382

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	11,538,402 - 11,564,931 (+)	NCBI
mRatBN7.2	4	10,645,957 - 10,672,486 (+)	NCBI
Rnor_6.0	4	7,173,961 - 7,200,752 (+)	NCBI
Rnor_5.0	4	7,186,479 - 7,212,119 (+)	NCBI
Celera	4	6,262,522 - 6,287,235 (+)	NCBI

Sequence:

show sequence

GCGCCGCGTCCTGACTCCTACGGATCGCCACTCCGTGCGCCCTGAGTCGCTCCTGGCGTCCCAC
GCGCCCCCGCCCCGCCCCGCCGCGCCCCTCTCGCCCTTCGAGCCGCGCCGAGCCCGGGTCCTGT
GGGCTGAGCCGGGAGCAGGTCCGGGCGCGGGGAGGGGACCTGGCCAGCTGCCGCCGCCGCCTCC
TCGCCCGCCGCAAACTTTCACAAAGCGGCGGGTCCGGCCTCATCAATCTGCATTAATAATAGTT
GGTTGGGCCGCGGGGGGCGGGCGGGGTCCCGGGCCGGCCGGGCCACTGGGAAGGCGCGGGGCGC
GGGGCGCGGGAGCCGGGCGCGGCGGCGGGCGGAGGGAGCAAGTGAAGCGTAATTTGAGGAAGAT
GGATGAGTCCGGAGGGCGACACCCCCAGCCCGCCCGCCCGCCCCCTCCCTCCTTATGAGCGAGG
GAGCGCGGCGCCGGAGCCACACTGCGCCGAGCCCGCGCCCCGCCGCTACCTCGGCCCGCGCGCC
CGCAGCGAGCCCTGCGTGTCCGCGCCGGGCGCACGGCGGGGCCCGGGCAGCGCCATGCAGAGAG
CGGCGGGCGGCGGCGCCCCCGGGGGCAGCGGCGGGAGCGGCGGCGGCCCCGGCACCGCCTTCTC
CATCGACTCGCTCATCGGGCCGCCGCCGCCGCGCTCGGGCCACCTGCTCTACACTGGCTACCCC
ATGTTCATGCCCTACCGGCCGCTCGTGCTGCCGCAGGCGCTGGCCCCGGCGCCGCTGCCCGCCG
GCCTGCCGCCGCTGGCCCCGCTCGCCTCGTTCGCGGGCCGCCTGAGCAACACCTTCTGCGCGGG
GCTGGGCCAGGCGGTGCCCTCGATGGTGGCGCTGACCACTGCACTGCCCAGCTTCGCAGAGCCC
CCCGACGCCTACTACGGACCCCCGGAGCTCGCCGCCGCCGCCGCCGCCGCCGCCGCCTCCACCG
TCTCGCGAAGCAACCCGGAGCCCCCGGCCCGGCGCACAGACGGAGCGCTGGATGCGGACGAGCT
GCTGCCTGCGCGCGAGAAAGTGACTGAGCCTCCGCCGCCCCCGCCGCCCCCGCCTCCGCACTTC
TCAGAGACTTTCCCGAGTCTGCCGGCAGAGGGGAAGGTGTACAGCTCAGATGAGGAGAAGCTGG
AGCCCCCAGCAGGAGAGCCAGCAGGCAGCGAGCCGGAGGAAGAAGGCTCAGGCGGTGACAGCGA
GGACAGCTTCCTGGACAGTTCTGCAGGGGGCCCAGGGGCTCTTCTGGGACCTAAACCGAAGCTA
AAGGGAAGCCTGGGGACTGGCGCAGAGGAGGGGACACCAGTGGCCACAGGGGTCACCACGCCTG
GGGGGAAAAGCCGAAGGCGGCGCACAGCCTTCACTAGCGAGCAGCTTTTGGAGCTGGAGAAGGA
GTTTCACTGCAAGAAATACCTGAGTCTGACCGAGCGCTCCCAGATCGCCCACGCCCTCAAGCTC
AGCGAGGTGCAGGTGAAGATCTGGTTTCAGAACCGCCGGGCCAAGTGGAAGCGAATCAAGGCTG
GCAATGTGAGCAGCCGTTCTGGGGAGCCCGTGAGAAACCCCAAGATCGTAGTGCCCATACCTGT
GCACGTCAACAGGTTTGCTGTGCGCAGCCAGCACCAACAGATGGAGCAGGGGGCCCGGCCATGA
CCAAGCTCCCGGGGACCGAAGTCAACGGATCTGAACCTGTGCCTGCCCAAGACTCACTGGGTGC
TGCAGCCTAGAGGGGCCTGGTGGACTCTGTTCTGGGAAAGACCAGCGTGTTCCCAGGACTGCGG
CATGAGTATTCGGCCAGAGACTGTTCTCGAGACCTCAGG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001258382	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF29535	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000017854
	ENSRNOP00000017854.5

RefSeq Acc Id:

NP_001258382 ⟸ NM_001271453

- UniProtKB:

F1M7G6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSPEGDTPSPPARPLPPYERGSAAPEPHCAEPAPRRYLGPRARSEPCVSAPGARRGPGSAMQRA
AGGGAPGGSGGSGGGPGTAFSIDSLIGPPPPRSGHLLYTGYPMFMPYRPLVLPQALAPAPLPAG
LPPLAPLASFAGRLSNTFCAGLGQAVPSMVALTTALPSFAEPPDAYYGPPELAAAAAAAAASTV
SRSNPEPPARRTDGALDADELLPAREKVTEPPPPPPPPPPHFSETFPSLPAEGKVYSSDEEKLE
PPAGEPAGSEPEEEGSGGDSEDSFLDSSAGGPGALLGPKPKLKGSLGTGAEEGTPVATGVTTPG
GKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRIKAG
NVSSRSGEPVRNPKIVVPIPVHVNRFAVRSQHQQMEQGARP

hide sequence

Ensembl Acc Id:

ENSRNOP00000017854 ⟸ ENSRNOT00000017854

Protein Domains

Homeobox

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1M7G6-F1-model_v2	AlphaFold	F1M7G6	1-425	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621864	AgrOrtholog
BioCyc Gene	G2FUF-46047	BioCyc
Ensembl Genes	ENSRNOG00000013369	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000017854	ENTREZGENE
	ENSRNOT00000017854.8	UniProtKB/TrEMBL
Gene3D-CATH	Homeodomain-like	UniProtKB/TrEMBL
InterPro	GBX-1/2	UniProtKB/TrEMBL
	Homeobox	UniProtKB/TrEMBL
	Homeobox_CS	UniProtKB/TrEMBL
	Homeobox_metazoa	UniProtKB/TrEMBL
	Homeodomain-like	UniProtKB/TrEMBL
KEGG Report	rno:246149	UniProtKB/TrEMBL
NCBI Gene	246149	ENTREZGENE
PANTHER	PTHR24334	UniProtKB/TrEMBL
	PTHR24334:SF2	UniProtKB/TrEMBL
Pfam	Homeobox	UniProtKB/TrEMBL
PhenoGen	Gbx1	PhenoGen
PRINTS	HOMEOBOX	UniProtKB/TrEMBL
PROSITE	HOMEOBOX_1	UniProtKB/TrEMBL
	HOMEOBOX_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000013369	RatGTEx
SMART	HOX	UniProtKB/TrEMBL
Superfamily-SCOP	Homeodomain_like	UniProtKB/TrEMBL
UniProt	F1M7G6	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-01-20	Gbx1	gastrulation brain homeobox 1		gastrulation brain homeo box 1	Name updated	1299863	APPROVED
2002-08-07	Gbx1	gastrulation brain homeo box 1			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar