Hopx (HOP homeobox) - Rat Genome Database

Name: Hopx
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Hopx (HOP homeobox) Rattus norvegicus

Analyze

Symbol:

Hopx

Name:

HOP homeobox

RGD ID:

621841

Description:

Predicted to enable histone deacetylase regulator activity. Predicted to be involved in chaperone-mediated protein complex assembly; positive regulation of gap junction assembly; and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including lung alveolus development; positive regulation of skeletal muscle tissue regeneration; and trophectodermal cell differentiation. Predicted to be active in nucleus. Orthologous to human HOPX (HOP homeobox); INTERACTS WITH 1-naphthyl isothiocyanate; 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

GIIg15b; global ischemia induced protein GIIG15B; global ischemia-induced gene 15B protein; global ischemia-induced protein 15B; Hod; homeobox only domain; homeodomain-only protein; LOC103693743; Obl; odd homeobox 1; odd homeobox protein 1; uncharacterized LOC103693743

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	HOPX (HOP homeobox)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):	Hopx (HOP homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Hopx (HOP homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	HOPX (HOP homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	HOPX (HOP homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Hopx (HOP homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	HOPX (HOP homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	HOPX (HOP homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Hopx (HOP homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Hopx (HOP homeobox)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	HOPX (HOP homeobox)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	hopx (HOP homeobox)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ceh-89	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	hopx	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	31,410,235 - 31,437,189 (+)	NCBI		GRCr8
mRatBN7.2	14	31,055,912 - 31,082,909 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	31,075,148 - 31,082,909 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	31,452,981 - 31,460,729 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	32,761,314 - 32,769,062 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	31,245,966 - 31,253,714 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	33,354,803 - 33,362,547 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	33,354,807 - 33,362,551 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	33,145,793 - 33,153,537 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	33,369,052 - 33,377,948 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	33,369,055 - 33,377,945 (+)	NCBI
Celera	14	30,388,376 - 30,396,113 (+)	NCBI		Celera
Cytogenetic Map	14	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

congenital disorder of glycosylation type IIk (ISO)

dilated cardiomyopathy (ISO)

Experimental Liver Cirrhosis (ISO)

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

4,4'-diaminodiphenylmethane (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

4-amino-2,6-dinitrotoluene (EXP)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

ammonium chloride (EXP)

amphetamine (EXP)

antimonite (ISO)

antirheumatic drug (ISO)

Archazolid B (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

beta-naphthoflavone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

C60 fullerene (EXP)

cadmium atom (ISO)

cadmium dichloride (EXP)

cantharidin (ISO)

carbon nanotube (ISO)

CHIR 99021 (ISO)

Cuprizon (EXP)

curcumin (EXP)

cyclosporin A (ISO)

dexamethasone (EXP,ISO)

diarsenic trioxide (ISO)

dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO)

diuron (EXP,ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

folic acid (ISO)

genistein (EXP)

gentamycin (EXP)

isoprenaline (ISO)

ketamine (EXP)

lead diacetate (ISO)

lipopolysaccharide (ISO)

methimazole (EXP)

methylmercury chloride (ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

N-methyl-4-phenylpyridinium (EXP)

N-nitrosodimethylamine (EXP)

N-Nitrosopyrrolidine (ISO)

nitrofen (ISO)

p-chloromercuribenzoic acid (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

pravastatin (EXP,ISO)

progesterone (EXP,ISO)

resveratrol (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

Soman (EXP)

streptozocin (EXP)

sunitinib (ISO)

tamoxifen (ISO)

temozolomide (ISO)

testosterone (EXP)

tetrachloromethane (ISO)

thioacetamide (EXP)

triazines (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

triptonide (ISO)

valproic acid (ISO)

vinclozolin (EXP)

WIN 18446 (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell differentiation (IEA)

chaperone-mediated protein complex assembly (ISO)

heart development (ISO)

lung alveolus development (ISO)

negative regulation of cell differentiation (ISO)

negative regulation of transcription by RNA polymerase II (ISO)

positive regulation of gap junction assembly (ISO)

positive regulation of skeletal muscle tissue regeneration (ISO)

positive regulation of striated muscle cell differentiation (ISO)

regulation of heart contraction (ISO)

regulation of transcription by RNA polymerase II (IBA,IEA)

trophectodermal cell differentiation (ISO)

Cellular Component

nucleus (IBA,IEA,ISO)

Molecular Function

DNA binding (IEA)

histone deacetylase regulator activity (ISO)

protein binding (ISO)

sequence-specific DNA binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
7.	Myocardin mRNA is augmented in the failing myocardium: expression profiling in the porcine model and human dilated cardiomyopathy.	Torrado M, etal., J Mol Med (Berl). 2003 Sep;81(9):566-77. doi: 10.1007/s00109-003-0470-7. Epub 2003 Aug 13.

Additional References at PubMed

PMID:10811660	PMID:12297045	PMID:12297046	PMID:12617835	PMID:12975471	PMID:14516659	PMID:15489334	PMID:15790958	PMID:16410412	PMID:16510470	PMID:17192267	PMID:17409236
PMID:17576768	PMID:20833366	PMID:34943964

Genomics

Comparative Map Data

Hopx
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	31,410,235 - 31,437,189 (+)	NCBI		GRCr8
mRatBN7.2	14	31,055,912 - 31,082,909 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	31,075,148 - 31,082,909 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	31,452,981 - 31,460,729 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	32,761,314 - 32,769,062 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	31,245,966 - 31,253,714 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	33,354,803 - 33,362,547 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	33,354,807 - 33,362,551 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	33,145,793 - 33,153,537 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	33,369,052 - 33,377,948 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	33,369,055 - 33,377,945 (+)	NCBI
Celera	14	30,388,376 - 30,396,113 (+)	NCBI		Celera
Cytogenetic Map	14	p11	NCBI

HOPX
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	56,647,998 - 56,681,706 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	56,647,989 - 56,681,877 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	57,514,164 - 57,547,462 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	57,208,921 - 57,242,322 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	4	55,011,890 - 55,053,984 (-)	NCBI		Celera
Cytogenetic Map	4	q12	NCBI
HuRef	4	53,468,140 - 53,501,835 (-)	NCBI		HuRef
CHM1_1	4	57,549,368 - 57,583,080 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	60,135,864 - 60,169,690 (-)	NCBI		T2T-CHM13v2.0

Hopx
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	77,234,831 - 77,262,970 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	77,234,835 - 77,262,968 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	77,086,986 - 77,115,123 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	77,086,988 - 77,115,121 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	77,516,011 - 77,544,148 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	78,161,763 - 78,189,898 (-)	NCBI		MGSCv36	mm8
Celera	5	74,355,315 - 74,383,496 (-)	NCBI		Celera
Cytogenetic Map	5	C3.3	NCBI
cM Map	5	41.45	NCBI

Hopx
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955447	14,417,014 - 14,417,797 (+)	NCBI	ChiLan1.0	ChiLan1.0

HOPX
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	73,097,055 - 73,130,533 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	73,302,586 - 73,336,058 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	67,240,801 - 67,274,419 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	73,835,888 - 73,843,787 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	73,833,886 - 73,843,060 (+)	Ensembl	panpan1.1		panPan2

HOPX
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	13	48,829,161 - 48,854,502 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	13	48,829,338 - 48,858,643 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	13	48,720,772 - 48,749,764 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	13	49,444,706 - 49,473,671 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	13	49,444,709 - 49,580,218 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	13	49,116,676 - 49,145,609 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	13	48,645,369 - 48,674,303 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	13	49,590,826 - 49,619,768 (-)	NCBI		UU_Cfam_GSD_1.0

Hopx
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405285	27,425,009 - 27,457,013 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936482	18,840,434 - 18,850,005 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936482	18,841,220 - 18,872,136 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HOPX
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	8	55,862,191 - 55,901,628 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	57,612,294 - 57,634,387 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HOPX
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	11,937,124 - 11,971,184 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	11,963,077 - 11,971,547 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666066	12,610,368 - 12,644,893 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hopx
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624761	12,776,137 - 12,807,042 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624761	12,776,215 - 12,806,879 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Hopx
189 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	449
Count of miRNA genes:	248
Interacting mature miRNAs:	291
Transcripts:	ENSRNOT00000049774
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
619619	Rf4	Renal disease susceptibility QTL 4	4.1	0.002	urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	14	1	32754612	Rat
634352	Apr6	Acute phase response QTL 6	3.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	14	1	41131407	Rat
1581500	Renag1	Renal agenesis QTL 1			kidney development trait (VT:0000527)	percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940)	14	8170668	68298175	Rat
1358296	Ael3	Aortic elastin QTL 3	3.7	0.00051	aorta elastin amount (VT:0003905)	aortic elastin	14	8267090	53267090	Rat
2302045	Pia39	Pristane induced arthritis QTL 39	4.9	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G2a level (CMO:0002116)	14	8267090	53267090	Rat
731183	Pia20	Pristane induced arthritis QTL 20	3.55		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	9088978	39057237	Rat
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11030622	95876975	Rat
71117	Niddm17	Non-insulin dependent diabetes mellitus QTL 17	2.35		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	14	17593761	42336881	Rat
631262	Tcas4	Tongue tumor susceptibility QTL 4	7.29		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	14	17622561	42337007	Rat
2313397	Coatc1	Coat color QTL1			coat/hair pigmentation trait (VT:0010463)	coat/hair color measurement (CMO:0001808)	14	18541332	63541332	Rat
61420	Pia6	Pristane induced arthritis QTL 6	4.9		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	14	18631345	42337007	Rat
10755459	Coatc15	Coat color QTL 15		0.01681	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	14	19836944	64836944	Rat
70187	Pancm5	Pancreatic morphology QTL 5	16.7		pancreas mass (VT:0010144)	pancreas weight to body weight ratio (CMO:0000630)	14	30320092	80829842	Rat
2324617	Coatc2	Coat color QTL 2		0.001	coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	14	30767025	39153750	Rat
1300154	Bp189	Blood pressure QTL 189	3.04		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	14	30883777	68757901	Rat

Markers in Region

AA875648

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	31,082,703 - 31,082,860 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	33,362,347 - 33,362,503	NCBI	Rnor6.0
Rnor_5.0	14	33,153,337 - 33,153,493	UniSTS	Rnor5.0
RGSC_v3.4	14	33,377,748 - 33,377,904	UniSTS	RGSC3.4
Celera	14	30,395,913 - 30,396,069	UniSTS
RH 3.4 Map	14	412.2	UniSTS
Cytogenetic Map	14	p11	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High												1
Medium	3	39	10		19		5	8	54	27	36	10	5
Low		4	47	41		41	3	3	20	8	5		3
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_133621	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039091595	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039091596	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039091597	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039091598	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC097433	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF474162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF492685	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC070950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473981	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212752	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220182	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220498	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220854	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221225	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222351	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222724	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223334	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223421	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229152	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229425	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229457	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229504	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229663	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229876	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229892	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230105	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230629	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233629	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000049774 ⟹ ENSRNOP00000044357

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	31,075,148 - 31,082,909 (+)	Ensembl
Rnor_6.0 Ensembl	14	33,354,807 - 33,362,551 (+)	Ensembl

RefSeq Acc Id:

NM_133621 ⟹ NP_598305

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	31,429,413 - 31,437,189 (+)	NCBI
mRatBN7.2	14	31,075,133 - 31,082,909 (+)	NCBI
Rnor_6.0	14	33,354,803 - 33,362,547 (+)	NCBI
Rnor_5.0	14	33,145,793 - 33,153,537 (+)	NCBI
RGSC_v3.4	14	33,369,052 - 33,377,948 (+)	RGD
Celera	14	30,388,376 - 30,396,113 (+)	RGD

Sequence:

show sequence

AAGAATTCGGCACGAGGCTCCGGACCTCCGGAGGCAGCTCTTGAGGAGCTTCCTCCACTGTCCC
CTCAGAGAGGCAGGCGAGAGGCTCTCCATCCTTAGCCAGACGCTCACGGACCATGTCGGCGCAG
ACTGCGAGCGGCCCCACGGAGGACCAGGTGGAGATCCTGGAGTACAACTTCAACAAGGTCAACA
AGCACCCCGACCCCACCACGCTGTGCCTCATCGCAGCCGAGGCGGGCCTCACGGAGGAGCAGAC
GCAGAAATGGTTTAAGCAGCGCCTGGCGGAGTGGCGGCGGTCAGAAGGCCTGCCTTCGGAATGC
AGATCGGTCACGGACTAGGGAGCCAGGCCCTTGAGCTTGCTCCCGGAACTTCCGTGCCTCAGTT
TACCCAGGCTGTTTTGATGTTTCAGTGCAGTGTTGAATGTCTCATTGTTTGCTGTCCTGCTGTT
TAACACAATGTGTTTTTTGAATGTATATAACTAAAGAAACAAAATAACAGGAAGCTAAATGCAG
TTCTGTGTAAAGCGATGGCTTGGCCGGGAGAGGGGTGTGGCTTACGTTTCTCTTTGGATTTTAA
TGAAAGATGATGTGGGAGCAGTTTTTGTTTGCCCTTGACCGCCACTTTCCAATCCGTATGTACC
ACCATCCGTTTCAGAGCATTCCAGAGCTGCCTGGCTTCTGTTGAGAAGTTAAAGGAACGGGCAG
GCAGGGGAGACACCTCAGTCCACCTTCCTGTGCCTCTTTCCTCCGCTTCACTTAACACTCTGGT
GGTTGGATGAGAACACGGGTGTATTTGAGTCATTCAATTTTTATATATTTGAAATATAGATATA
TAAAACAGTTCCTTCTCTTACAGCTGCGTTACCTTGGAAAACACCCTCGTTTAGCAGCGACAGA
TTCCAAGGGGCAGAAAAGCAGGTAGCTAGGGAAAAAAAGTTACAGAGTCTAGAATCTACCTTAT
TTAAATGAACTTGTTACATTTATTTTGCTGAATAACATGAACCGCTTTTTTTTGTCCCAAAAAT
TATATTTTAAATAAAAAACTTTGGGATCCCAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039091595 ⟹ XP_038947523

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	31,410,235 - 31,437,189 (+)	NCBI
mRatBN7.2	14	31,055,912 - 31,082,909 (+)	NCBI

RefSeq Acc Id:

XM_039091596 ⟹ XP_038947524

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	31,414,169 - 31,437,189 (+)	NCBI
mRatBN7.2	14	31,059,887 - 31,082,909 (+)	NCBI

RefSeq Acc Id:

XM_039091597 ⟹ XP_038947525

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	31,428,746 - 31,437,189 (+)	NCBI
mRatBN7.2	14	31,074,465 - 31,082,909 (+)	NCBI

RefSeq Acc Id:

XM_039091598 ⟹ XP_038947526

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	31,428,892 - 31,437,189 (+)	NCBI
mRatBN7.2	14	31,074,641 - 31,082,909 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_598305	(Get FASTA)	NCBI Sequence Viewer
	XP_038947523	(Get FASTA)	NCBI Sequence Viewer
	XP_038947524	(Get FASTA)	NCBI Sequence Viewer
	XP_038947525	(Get FASTA)	NCBI Sequence Viewer
	XP_038947526	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH70950	(Get FASTA)	NCBI Sequence Viewer
	AAL85327	(Get FASTA)	NCBI Sequence Viewer
	AAM46837	(Get FASTA)	NCBI Sequence Viewer
	EDL89880	(Get FASTA)	NCBI Sequence Viewer
	EDL89881	(Get FASTA)	NCBI Sequence Viewer
	EDL89882	(Get FASTA)	NCBI Sequence Viewer
	EDL89883	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000044357.3
	ENSRNOP00065027217
GenBank Protein	Q78ZR5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_598305 ⟸ NM_133621
- UniProtKB:	Q8R4G4 (UniProtKB/Swiss-Prot), Q78ZR5 (UniProtKB/Swiss-Prot), A6JCV9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSAQTASGPTEDQVEILEYNFNKVNKHPDPTTLCLIAAEAGLTEEQTQKWFKQRLAEWRRSEGL PSECRSVTD hide sequence

RefSeq Acc Id:

ENSRNOP00000044357 ⟸ ENSRNOT00000049774

RefSeq Acc Id:	XP_038947523 ⟸ XM_039091595
- Peptide Label:	isoform X1
- UniProtKB:	Q78ZR5 (UniProtKB/Swiss-Prot), Q8R4G4 (UniProtKB/Swiss-Prot), A6JCV9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038947524 ⟸ XM_039091596
- Peptide Label:	isoform X1
- UniProtKB:	Q78ZR5 (UniProtKB/Swiss-Prot), Q8R4G4 (UniProtKB/Swiss-Prot), A6JCV9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038947525 ⟸ XM_039091597
- Peptide Label:	isoform X1
- UniProtKB:	Q78ZR5 (UniProtKB/Swiss-Prot), Q8R4G4 (UniProtKB/Swiss-Prot), A6JCV9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038947526 ⟸ XM_039091598
- Peptide Label:	isoform X1
- UniProtKB:	Q78ZR5 (UniProtKB/Swiss-Prot), Q8R4G4 (UniProtKB/Swiss-Prot), A6JCV9 (UniProtKB/TrEMBL)

Protein Domains

Homeobox

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q78ZR5-F1-model_v2	AlphaFold	Q78ZR5	1-73	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621841	AgrOrtholog
BioCyc Gene	G2FUF-15978	BioCyc
Ensembl Genes	ENSRNOG00000024689	Ensembl, UniProtKB/TrEMBL
	ENSRNOG00065020152	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000049774.5	UniProtKB/TrEMBL
	ENSRNOT00065033999	UniProtKB/Swiss-Prot
Gene3D-CATH	Homeodomain-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7098349	IMAGE-MGC_LOAD
InterPro	Homeobox-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Homeobox_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HOPX	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:171160	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:91403	IMAGE-MGC_LOAD
NCBI Gene	171160	ENTREZGENE
PANTHER	HOMEODOMAIN-ONLY PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR21408	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Homeodomain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Hopx	PhenoGen
PROSITE	HOMEOBOX_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000024689	RatGTEx
	ENSRNOG00065020152	RatGTEx
SMART	HOX	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF46689	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8L2QMF2_RAT	UniProtKB/TrEMBL
	A6JCV9	ENTREZGENE, UniProtKB/TrEMBL
	HOP_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q8R4G4	ENTREZGENE
UniProt Secondary	Q8R4G4	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Hopx	HOP homeobox	LOC103693743	uncharacterized LOC103693743	Data merged from RGD:9231553	737654	PROVISIONAL
2014-08-25	LOC103693743	uncharacterized LOC103693743			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-02-25	Hopx	HOP homeobox	Hod	homeobox only domain	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Hod	homeobox only domain	GIIg15b	global ischemia induced protein GIIG15B	Symbol and Name updated	1299863	APPROVED
2002-08-07	GIIg15b	global ischemia induced protein GIIG15B			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD