Advanced Search (OLGA)

Gene: Foxe3 (forkhead box E3) Rattus norvegicus

Analyze

Symbol:

Foxe3

Name:

forkhead box E3

RGD ID:

621727

Description:

Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in several processes, including camera-type eye development; mRNA transcription by RNA polymerase II; and negative regulation of lens fiber cell differentiation. Predicted to act upstream of or within several processes, including camera-type eye development; positive regulation of epithelial cell proliferation; and transcription by RNA polymerase II. Predicted to be located in nucleus. Predicted to be part of transcription regulator complex. Human ortholog(s) of this gene implicated in anterior segment dysgenesis; anterior segment dysgenesis 2; cataract 34 multiple types; and thoracic aortic aneurysm. Orthologous to human FOXE3 (forkhead box E3); INTERACTS WITH ammonium chloride; bisphenol A; capsaicin.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

forkhead box protein E3; forkhead-related protein FKHL12; forkhead-related transcription factor 8; FREAC-8; hepatocyte nuclear factor 3 forkhead homolog 7; HFH-7; HFH7; HNF3; LOC313505

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FOXE3 (forkhead box E3)	HGNC	EggNOG, Ensembl, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Foxe3 (forkhead box E3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FOXE3 (forkhead box E3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FOXE3 (forkhead box E3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Foxe3 (forkhead box E3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FOXE3 (forkhead box E3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FOXE3 (forkhead box E3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Foxe3 (forkhead box E3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Foxe3 (forkhead box E3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	FOXE1 (forkhead box E1)	HGNC	Treefam
Alliance orthologs ³
Homo sapiens (human):	FOXE3 (forkhead box E3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Foxe3 (forkhead box E3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	foxe3 (forkhead box E3)	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	foxe3 (forkhead box E3)	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	FKH1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	foxe3	Alliance	DIOPT (Hieranoid\|OrthoFinder)
Xenopus tropicalis (tropical clawed frog):	foxe3	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	133,681,684 - 133,683,266 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	133,681,702 - 133,683,266 (-)	Ensembl				GRCr8
mRatBN7.2	5	128,444,912 - 128,446,494 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	128,445,594 - 128,446,454 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	131,134,744 - 131,135,604 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	132,864,382 - 132,865,242 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	132,886,063 - 132,886,923 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	133,724,796 - 133,725,656 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	133,724,796 - 133,725,656 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	137,517,035 - 137,517,895 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	135,285,688 - 135,286,548 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	127,097,587 - 127,098,447 (-)	NCBI		Celera
RGSC_v3.1	5	135,291,289 - 135,291,591 (-)	NCBI
Cytogenetic Map	5	q35	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

anterior segment dysgenesis (ISO)

anterior segment dysgenesis 2 (ISO)

Aphakia (ISO)

cataract 34 multiple types (ISO)

congenital aphakia (ISO,ISS)

Familial Thoracic Aortic Aneurysm 11 (ISO)

retinitis pigmentosa 1 (ISO)

thoracic aortic aneurysm (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (ISO)

ammonium chloride (EXP)

amosite asbestos (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

capsaicin (EXP)

choline (ISO)

crocidolite asbestos (ISO)

decabromodiphenyl ether (EXP)

dimethylarsinic acid (EXP)

folic acid (ISO)

fulvestrant (ISO)

L-methionine (ISO)

Licochalcone B (ISO)

methotrexate (ISO)

Theaflavin 3,3'-digallate (ISO)

titanium dioxide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

anatomical structure morphogenesis (IBA)

animal organ development (IEA)

camera-type eye development (ISO)

cell development (ISO)

cell differentiation (IBA)

ciliary body morphogenesis (IEA,ISO,ISS)

cornea development in camera-type eye (IEA,ISO,ISS)

eye development (IEA,ISO,ISS)

iris morphogenesis (IEA,ISO,ISS)

lens development in camera-type eye (IEA,ISO,ISS)

mRNA transcription by RNA polymerase II (IEA,ISO,ISS)

negative regulation of apoptotic process (IEA,ISO,ISS)

negative regulation of lens fiber cell differentiation (IEA,ISO,ISS)

positive regulation of epithelial cell proliferation (ISO)

positive regulation of lens epithelial cell proliferation (IEA,ISO,ISS)

regulation of cell cycle (IEA,ISO,ISS)

regulation of DNA-templated transcription (IEA)

regulation of transcription by RNA polymerase II (IBA)

system development (IEA)

trabecular meshwork development (IEA,ISO,ISS)

transcription by RNA polymerase II (ISO)

Cellular Component

nucleus (IEA,ISO,ISS)

transcription regulator complex (IEA,ISO)

Molecular Function

DNA binding (IEA,ISO,ISS)

DNA-binding transcription factor activity (IEA,ISO,ISS,NAS)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA)

sequence-specific DNA binding (IEA,ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Foxe3 is required for morphogenesis and differentiation of the anterior segment of the eye and is sensitive to Pax6 gene dosage.	Blixt A, etal., Dev Biol. 2007 Feb 1;302(1):218-29. Epub 2006 Sep 16.
2.	Identification of nine tissue-specific transcription factors of the hepatocyte nuclear factor 3/forkhead DNA-binding-domain family.	Clevidence DE, etal., Proc Natl Acad Sci U S A 1993 May 1;90(9):3948-52.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Functional analysis of FOXE3 mutations causing dominant and recessive ocular anterior segment disease.	Islam L, etal., Hum Mutat. 2015 Mar;36(3):296-300. doi: 10.1002/humu.22741.
5.	Severe defects in proliferation and differentiation of lens cells in Foxe3 null mice.	Medina-Martinez O, etal., Mol Cell Biol. 2005 Oct;25(20):8854-63.
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
8.	Foxe3 haploinsufficiency in mice: a model for Peters' anomaly.	Ormestad M, etal., Invest Ophthalmol Vis Sci. 2002 May;43(5):1350-7.
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Comprehensive gene review and curation	RGD comprehensive gene curation
13.	Mutations in the human forkhead transcription factor FOXE3 associated with anterior segment ocular dysgenesis and cataracts.	Semina EV, etal., Hum Mol Genet. 2001 Feb 1;10(3):231-6.
14.	Homozygous nonsense mutation in the FOXE3 gene as a cause of congenital primary aphakia in humans.	Valleix S, etal., Am J Hum Genet. 2006 Aug;79(2):358-64. Epub 2006 Jun 8.
15.	Growth inhibition of human lens epithelial cells by short hairpin RNA in transcription factor forkhead box E3 (FOXE3).	Wang Y, etal., Graefes Arch Clin Exp Ophthalmol. 2012 Jul;250(7):999-1007. doi: 10.1007/s00417-012-1944-5. Epub 2012 Apr 18.

Additional References at PubMed

PMID:10652278	PMID:10890982	PMID:11309658	PMID:27218149

Genomics

Comparative Map Data

Foxe3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	133,681,684 - 133,683,266 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	133,681,702 - 133,683,266 (-)	Ensembl				GRCr8
mRatBN7.2	5	128,444,912 - 128,446,494 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	128,445,594 - 128,446,454 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	131,134,744 - 131,135,604 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	132,864,382 - 132,865,242 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	132,886,063 - 132,886,923 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	133,724,796 - 133,725,656 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	133,724,796 - 133,725,656 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	137,517,035 - 137,517,895 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	135,285,688 - 135,286,548 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	127,097,587 - 127,098,447 (-)	NCBI		Celera
RGSC_v3.1	5	135,291,289 - 135,291,591 (-)	NCBI
Cytogenetic Map	5	q35	NCBI

FOXE3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	47,416,285 - 47,418,052 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	47,416,285 - 47,418,052 (+)	Ensembl			hg38	GRCh38
GRCh37	1	47,881,957 - 47,883,724 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	47,654,331 - 47,656,311 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	47,593,763 - 47,595,743	NCBI
Celera	1	46,168,009 - 46,170,038 (+)	NCBI		Celera
Cytogenetic Map	1	p33	NCBI
HuRef	1	45,998,176 - 46,000,072 (+)	NCBI		HuRef
CHM1_1	1	47,998,586 - 48,000,566 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	47,294,744 - 47,296,511 (+)	NCBI		T2T-CHM13v2.0

Foxe3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	114,781,640 - 114,783,264 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	114,782,344 - 114,783,210 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	114,924,443 - 114,926,067 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	114,925,147 - 114,926,013 (-)	Ensembl			mm10	GRCm38
MGSCv37	4	114,597,752 - 114,598,618 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	114,423,079 - 114,423,945 (-)	NCBI		MGSCv36	mm8
Celera	4	113,672,921 - 113,673,787 (-)	NCBI		Celera
Cytogenetic Map	4	D1	NCBI
cM Map	4	52.73	NCBI

FOXE3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	179,398,703 - 179,400,477 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	178,540,120 - 178,541,894 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	46,710,791 - 46,712,771 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

FOXE3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	13,291,160 - 13,295,982 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	13,445,213 - 13,446,211 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	13,441,830 - 13,442,846 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	13,441,830 - 13,443,020 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	13,241,940 - 13,242,931 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	13,309,628 - 13,310,638 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	13,379,114 - 13,380,118 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Foxe3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	62,386,321 - 62,388,211 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	28,211,313 - 28,212,272 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	28,211,144 - 28,212,963 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FOXE3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	164,132,034 - 164,133,011 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	164,130,638 - 164,133,218 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	151,682,360 - 151,687,569 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FOXE3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	85,502,938 - 85,505,158 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	85,504,126 - 85,505,076 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666033	31,577,474 - 31,579,685 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Foxe3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624859	5,412,280 - 5,414,737 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Foxe3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	41,657,483 - 41,659,148 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Foxe3
2 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	57
Count of miRNA genes:	53
Interacting mature miRNAs:	57
Transcripts:	ENSRNOT00000010208
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	102105698	152749382	Rat
2303586	Gluco52	Glucose level QTL 52	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	100826632	145826632	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	130249266	172190305	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	44924861	153890773	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	116702075	161702075	Rat
1354583	Despr3	Despair related QTL3	4.98	0.0002	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	5	132930505	172190305	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	38207390	136631402	Rat
1300122	Wbc1	White blood cell count QTL 1	2.75		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	5	130678987	145274255	Rat
7365049	Bp359	Blood pressure QTL 359			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	133308734	140009902	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	99905133	172190305	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	48523123	134369373	Rat
7411582	Foco3	Food consumption QTL 3	7.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	92583776	137583776	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	65089051	166764498	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	112142946	157142946	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	112142946	157142946	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	110770739	155770739	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	133081618	172190305	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	51657967	166600247	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	112142946	157142946	Rat
1581505	Rf54	Renal function QTL 54			kidney physiology trait (VT:0002136)	kidney 20-HETE level (CMO:0001854)	5	133270647	172190305	Rat
7411564	Bw135	Body weight QTL 135		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	92583776	137583776	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	98972960	143972960	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	125969677	172190305	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55124766	172190305	Rat
7411601	Foco12	Food consumption QTL 12	19.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	92583776	137583776	Rat
2303618	Vencon1	Ventilatory control QTL 1	3.8		respiration trait (VT:0001943)	oxygen consumption (CMO:0002169)	5	100826632	145826632	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	111236572	156236572	Rat
7394710	Emca12	Estrogen-induced mammary cancer QTL 12			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	94034903	139034903	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	131708216	172190305	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	114131300	159131300	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	125969677	156302135	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	60601597	137492949	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	112142946	157142946	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	116702075	161702075	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	112142946	157142946	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	116702075	161702075	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	36460764	136631402	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	74335621	156302135	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	116702075	161702075	Rat
1298086	Bp156	Blood pressure QTL 156			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	89369373	134369373	Rat
2306971	Anxrr21	Anxiety related response QTL 21	9.47		fear/anxiety-related behavior trait (VT:1000241)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	5	70969494	136328156	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	114131300	159131300	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	133081618	172190305	Rat
6903316	Bw113	Body weight QTL 113	2	0.0103	body mass (VT:0001259)	body weight (CMO:0000012)	5	92881678	137881678	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	104262817	153890625	Rat

Markers in Region

Foxe3

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	128,445,627 - 128,446,017 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	133,724,830 - 133,725,219	NCBI	Rnor6.0
Rnor_5.0	5	137,517,069 - 137,517,458	UniSTS	Rnor5.0
Celera	5	127,097,621 - 127,098,010	UniSTS
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	hemolymphoid system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
13	1	7	38	16	8	3	5	55	24	2	25	18	26	8	1	1

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_134339	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L13207	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010208 ⟹ ENSRNOP00000010208

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	133,681,702 - 133,683,266 (-)	Ensembl
mRatBN7.2 Ensembl	5	128,445,594 - 128,446,454 (-)	Ensembl
Rnor_6.0 Ensembl	5	133,724,796 - 133,725,656 (-)	Ensembl

RefSeq Acc Id:

NM_134339 ⟹ NP_599166

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	133,681,684 - 133,683,266 (-)	NCBI
mRatBN7.2	5	128,444,912 - 128,446,494 (-)	NCBI
Rnor_6.0	5	133,724,796 - 133,725,656 (-)	NCBI
Rnor_5.0	5	137,517,035 - 137,517,895 (-)	NCBI
Celera	5	127,097,587 - 127,098,447 (-)	NCBI

Sequence:

show sequence

ATGGATGCGCACGTCGCTTTCTCCGGCTTTCCGACCCTGCCCTCGGTCTCGCCGTCGGGGCCGC
AGCCTCCATCGCTGGCCGGAGACGAGCCCGGGCGCGAACCAGAGGAGGTGGTGGGCGGTGGGGA
CTCCGAGCCCCCGGCCGCGCCGGGCCCTGGGAGGCGACGTCGGCGGCCGCTACAGCGTGGGAAG
CCGCCTTACTCGTACATCGCTCTTATCGCTATGGCCCTGGCGCACGCTCCGGGCCGTCGTCTCA
CGCTGGCAGCCATCTACCGCTTCATCACCGAGCGCTTCGCCTTCTACCGCGACAGCCCGCGCAA
GTGGCAGAACAGCATCCGCCACAACCTCACCCTCAACGACTGCTTCGTCAAGGTGCCGCGCGAG
CCGGGCAATCCGGGCAAGGGCAACTACTGGACGCTCGATCCCGCGGCCGCCGACATGTTCGACA
ACGGCAGCTTCCTGCGGCGCCGCAAGCGCTTTAAGCGCACCGAGCTGCCCGCGCCGCCGCCACC
GCCCTTTCCCTACGCGCCCTTCCCGCCCGCACCTGCACCTGCGCCCGCACCGCCCGCGCGCCTC
TTCCGCCTGGACAGCCTGCTGGGCTTGCAAACCGAGCCGCCAGGACCCTTGGCGCCCGAGCCGC
CTTGCTGCGCCGCGCCCGACGCCTCCTTCCCGCCCTGCGCCGCCGCAGCCTCGCCGCCGCTCTA
CTCGCCCGCGCCCGAGCGCCTGGGGCTGCCCGCGCCGTTGCCGGCGGAGCCTCTCCTGGCCTTG
GCAGGATCGGCTGGCGCGCTGGGGCCACTCGGCGCCGGAGAAGCCTACCTGAGACAGCCGGGCT
TCCCGCCCGGGCTGGAGCGCTACCTGTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_599166	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41323	(Get FASTA)	NCBI Sequence Viewer
	EDL90326	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010208
	ENSRNOP00000010208.1
GenBank Protein	Q63250	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_599166 ⟸ NM_134339

- UniProtKB:

G3V6Y8 (UniProtKB/Swiss-Prot), Q63250 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MDAHVAFSGFPTLPSVSPSGPQPPSLAGDEPGREPEEVVGGGDSEPPAAPGPGRRRRRPLQRGK
PPYSYIALIAMALAHAPGRRLTLAAIYRFITERFAFYRDSPRKWQNSIRHNLTLNDCFVKVPRE
PGNPGKGNYWTLDPAAADMFDNGSFLRRRKRFKRTELPAPPPPPFPYAPFPPAPAPAPAPPARL
FRLDSLLGLQTEPPGPLAPEPPCCAAPDASFPPCAAAASPPLYSPAPERLGLPAPLPAEPLLAL
AGSAGALGPLGAGEAYLRQPGFPPGLERYL

hide sequence

Ensembl Acc Id:

ENSRNOP00000010208 ⟸ ENSRNOT00000010208

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q63250-F1-model_v2	AlphaFold	Q63250	1-286	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621727	AgrOrtholog
BioCyc Gene	G2FUF-40308	BioCyc
Ensembl Genes	ENSRNOG00000007770	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000010208	ENTREZGENE
	ENSRNOT00000010208.3	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.10.10	UniProtKB/Swiss-Prot
InterPro	Fork_head_dom	UniProtKB/Swiss-Prot
	FOX_domain-containing	UniProtKB/Swiss-Prot
	TF_fork_head_CS_1	UniProtKB/Swiss-Prot
	TF_fork_head_CS_2	UniProtKB/Swiss-Prot
	WH-like_DNA-bd_sf	UniProtKB/Swiss-Prot
	WH_DNA-bd_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:171302	UniProtKB/Swiss-Prot
NCBI Gene	171302	ENTREZGENE
PANTHER	FORKHEAD BOX PROTEIN	UniProtKB/Swiss-Prot
	FORKHEAD BOX PROTEIN E3	UniProtKB/Swiss-Prot
Pfam	Forkhead	UniProtKB/Swiss-Prot
PhenoGen	Foxe3	PhenoGen
PRINTS	FORKHEAD	UniProtKB/Swiss-Prot
PROSITE	FORK_HEAD_1	UniProtKB/Swiss-Prot
	FORK_HEAD_2	UniProtKB/Swiss-Prot
	FORK_HEAD_3	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000007770	RatGTEx
SMART	SM00339	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF46785	UniProtKB/Swiss-Prot
UniProt	FOXE3_RAT	UniProtKB/Swiss-Prot
	G3V6Y8	ENTREZGENE
	Q63250	ENTREZGENE
UniProt Secondary	G3V6Y8	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-04-28	Foxe3	forkhead box E3	Foxe3_predicted	forkhead box E3 (predicted)	Data merged from RGD:1307553	737654	APPROVED
2005-01-20	Foxe3	forkhead box E3			Symbol and Name status set to approved	1299863	APPROVED
2005-01-12	Foxe3_predicted	forkhead box E3 (predicted)			Symbol and Name status set to approved	70820	APPROVED
2002-08-07	Foxe3	forkhead box E3			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in liver, brain, kidney, lung and intestine and have a tissue-restricted expression pattern	632667

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM