Advanced Search (OLGA)

Gene: Foxe1 (forkhead box E1) Rattus norvegicus

Analyze

Symbol:

Foxe1

Name:

forkhead box E1

RGD ID:

621723

Description:

Enables DNA binding activity and DNA-binding transcription factor activity, RNA polymerase II-specific. Involved in cellular response to insulin stimulus and negative regulation of DNA-templated transcription. Acts upstream of or within negative regulation of transcription by RNA polymerase II. Predicted to be located in nucleus. Human ortholog(s) of this gene implicated in Bamforth-Lazarus syndrome and papillary thyroid carcinoma. Orthologous to human FOXE1 (forkhead box E1); INTERACTS WITH 1,2-dimethylhydrazine; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

forkhead box E1 (thyroid transcription factor 2); forkhead box protein E1; Ttf-2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FOXE1 (forkhead box E1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Foxe1 (forkhead box E1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Foxe1 (forkhead box E1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FOXE1 (forkhead box E1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FOXE1 (forkhead box E1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Foxe1 (forkhead box E1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FOXE1 (forkhead box E1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FOXE1 (forkhead box E1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Foxe1 (forkhead box E1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	FOXE3 (forkhead box E3)	HGNC	Treefam
Alliance orthologs ³
Homo sapiens (human):	FOXE1 (forkhead box E1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Foxe1 (forkhead box E1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	foxe3 (forkhead box E3)	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER)
Danio rerio (zebrafish):	foxe1 (forkhead box E1)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	foxe1 (forkhead box E1)	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	FKH1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	fkh-6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	foxe1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	foxe1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	foxe3	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector)
Xenopus tropicalis (tropical clawed frog):	foxe3	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	65,425,630 - 65,428,438 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	65,425,630 - 65,428,438 (+)	Ensembl				GRCr8
mRatBN7.2	5	60,630,027 - 60,632,835 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	60,630,027 - 60,632,835 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	62,601,890 - 62,604,694 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	64,421,389 - 64,424,193 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	64,390,654 - 64,393,458 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	61,954,549 - 61,957,357 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	61,954,549 - 61,957,357 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	66,467,889 - 66,470,697 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	62,905,210 - 62,908,018 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	59,189,463 - 59,192,271 (+)	NCBI		Celera
RGSC_v3.1	5	62,905,388 - 62,908,197 (+)	NCBI
Cytogenetic Map	5	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Bamforth-Lazarus syndrome (ISO,ISS)

congenital hypothyroidism (ISS)

genetic disease (ISO)

Thyroid Cancer, Nonmedullary, 4 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (EXP)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

atrazine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium dichloride (EXP)

cefaloridine (EXP)

chromium(6+) (ISO)

decabromodiphenyl ether (EXP)

diethylstilbestrol (EXP)

formaldehyde (ISO)

furan (EXP)

gentamycin (EXP)

lipopolysaccharide (ISO)

methamphetamine (EXP)

N-methyl-4-phenylpyridinium (EXP)

ozone (ISO)

paracetamol (EXP)

perfluorooctanoic acid (EXP)

potassium iodide (EXP)

rac-lactic acid (ISO)

raloxifene (EXP)

resveratrol (EXP,ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

sodium arsenite (ISO)

titanium dioxide (ISO)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

animal organ development (IEA)

cell migration (ISO)

cellular response to insulin stimulus (IEP)

chordate pharynx development (IEA,ISO)

cranial skeletal system development (IEA,ISO)

embryonic organ morphogenesis (ISO)

hair follicle morphogenesis (ISO)

hard palate development (IEA,ISO)

negative regulation of DNA-templated transcription (IDA)

negative regulation of transcription by RNA polymerase II (IDA)

positive regulation of DNA-templated transcription (IEA,ISO)

regulation of DNA-templated transcription (IEA)

regulation of transcription by RNA polymerase II (IEA,ISO)

roof of mouth development (IEA,ISO)

soft palate development (IEA,ISO)

system development (IEA)

thymus development (IEA,ISO)

thyroid gland development (IEA,ISO)

thyroid hormone generation (ISO)

Cellular Component

nucleus (IEA,ISO)

Molecular Function

DNA binding (IDA,IEA)

DNA-binding transcription factor activity (IEA,ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IDA,IEA,ISO)

protein binding (ISO)

sequence-specific DNA binding (IEA,ISO)

sequence-specific double-stranded DNA binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Tumor necrosis factor-alpha and interferon-gamma suppress both gene expression and deoxyribonucleic acid-binding of TTF-2 in FRTL-5 cells.	Miyazaki A, etal., Endocrinology. 1999 Sep;140(9):4214-20.
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
7.	Online Mendelian Inheritance in Man, OMIM (TM).	Online Mendelian Inheritance in Man, OMIM (TM).
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	TTF-2, a new forkhead protein, shows a temporal expression in the developing thyroid which is consistent with a role in controlling the onset of differentiation.	Zannini M, etal., EMBO J 1997 Jun 2;16(11):3185-97.

Additional References at PubMed

PMID:9697704	PMID:9697705	PMID:12165566	PMID:15367491	PMID:15494458	PMID:15581879	PMID:16882747	PMID:17709379	PMID:20094846	PMID:20484477	PMID:21177256	PMID:23675434
PMID:24219130	PMID:26610751	PMID:38396644

Genomics

Comparative Map Data

Foxe1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	65,425,630 - 65,428,438 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	65,425,630 - 65,428,438 (+)	Ensembl				GRCr8
mRatBN7.2	5	60,630,027 - 60,632,835 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	60,630,027 - 60,632,835 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	62,601,890 - 62,604,694 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	64,421,389 - 64,424,193 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	64,390,654 - 64,393,458 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	61,954,549 - 61,957,357 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	61,954,549 - 61,957,357 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	66,467,889 - 66,470,697 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	62,905,210 - 62,908,018 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	59,189,463 - 59,192,271 (+)	NCBI		Celera
RGSC_v3.1	5	62,905,388 - 62,908,197 (+)	NCBI
Cytogenetic Map	5	q22	NCBI

FOXE1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	97,853,226 - 97,856,717 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	97,853,226 - 97,856,717 (+)	Ensembl			hg38	GRCh38
GRCh37	9	100,615,508 - 100,618,999 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	99,655,358 - 99,658,818 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	9	97,695,091 - 97,698,551	NCBI
Celera	9	71,129,774 - 71,133,234 (+)	NCBI		Celera
Cytogenetic Map	9	q22.33	NCBI
HuRef	9	70,216,543 - 70,219,997 (+)	NCBI		HuRef
CHM1_1	9	100,762,045 - 100,765,505 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	110,025,163 - 110,028,654 (+)	NCBI		T2T-CHM13v2.0

Foxe1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	46,343,644 - 46,345,774 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	46,343,609 - 46,346,412 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	46,343,644 - 46,345,774 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	46,343,609 - 46,346,412 (+)	Ensembl			mm10	GRCm38
MGSCv37	4	46,357,066 - 46,358,181 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	46,365,294 - 46,366,409 (+)	NCBI		MGSCv36	mm8
Celera	4	46,367,115 - 46,367,868 (+)	NCBI		Celera
Cytogenetic Map	4	B1	NCBI
cM Map	4	24.68	NCBI

Foxe1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955419	27,616,606 - 27,619,908 (-)	NCBI	ChiLan1.0	ChiLan1.0

FOXE1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	41,597,938 - 41,603,950 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	41,602,840 - 41,606,327 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	68,943,747 - 68,947,226 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	97,065,256 - 97,068,012 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2

FOXE1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	55,143,389 - 55,145,954 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	53,577,184 - 53,581,792 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	56,255,506 - 56,260,128 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	56,255,506 - 56,256,645 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	54,751,785 - 54,756,398 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	54,782,205 - 54,784,957 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	55,478,710 - 55,483,334 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Foxe1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	170,071,548 - 170,076,050 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936524	6,619,128 - 6,620,278 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936524	6,619,128 - 6,620,278 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FOXE1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	239,727,855 - 239,728,976 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	1	239,727,769 - 239,732,461 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	267,835,277 - 267,838,164 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FOXE1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	41,555,901 - 41,559,914 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	41,557,568 - 41,558,686 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666038	38,608,731 - 38,612,197 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Foxe1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624825	2,980,176 - 2,981,303 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624825	2,979,447 - 2,981,412 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Foxe1
7 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	131
Count of miRNA genes:	95
Interacting mature miRNAs:	118
Transcripts:	ENSRNOT00000012637
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	38011670	83011670	Rat
1300115	Hrtrt7	Heart rate QTL 7	2.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	52665372	94894052	Rat
1578776	Stresp18	Stress response QTL 18	2.9		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	5	32751649	77751649	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	44924861	153890773	Rat
6907115	Mcs29	Mammary carcinoma susceptibility QTL 29			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	38004331	83004331	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	38207390	136631402	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	23671493	79046465	Rat
61386	Bp49	Blood pressure QTL 49	16.6		cerebrum integrity trait (VT:0010549)	brain infarction volume (CMO:0001013)	5	65089051	103648916	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	48523123	134369373	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	38011670	83011670	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	38011670	83011670	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	65089051	166764498	Rat
1331782	Rf36	Renal function QTL 36	3.296		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	39019942	102105896	Rat
6903292	Stl28	Serum triglyceride level QTL 28	2.6	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	5	33311673	78311673	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	51657967	166600247	Rat
1578767	Stresp17	Stress response QTL 17	4.3	0.01	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	5	32751649	77751649	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55124766	172190305	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	39985948	84985948	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	6922282	81330203	Rat
6903306	Scl35	Serum cholesterol QTL 35	2.6	0.0073	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33311673	78311673	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	39526924	84526924	Rat
1331773	Scl26	Serum cholesterol level QTL 26	3.065		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	48523123	91770353	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	60601597	137492949	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	10019064	91770353	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	60511627	105511627	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	36460764	136631402	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	64589016	109589016	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	7065535	74335773	Rat
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	10019064	87027358	Rat
8552954	Pigfal14	Plasma insulin-like growth factor 1 level QTL 14	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	26023211	71023211	Rat
2316954	Rf57	Renal function QTL 57	0		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	64589016	93503770	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	56546393	101546393	Rat
1600358	Mamtr5	Mammary tumor resistance QTL 5			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	23671493	68671493	Rat
2316957	Pur21	Proteinuria QTL 21	6.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	5	64589016	91762830	Rat

Markers in Region

RH131729

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	5	65,428,148 - 65,428,332 (+)	Marker Load Pipeline
mRatBN7.2	5	60,632,545 - 60,632,729 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	61,957,068 - 61,957,251	NCBI	Rnor6.0
Rnor_5.0	5	66,470,408 - 66,470,591	UniSTS	Rnor5.0
RGSC_v3.4	5	62,907,729 - 62,907,912	UniSTS	RGSC3.4
Celera	5	59,191,982 - 59,192,165	UniSTS
RH 3.4 Map	5	380.3	UniSTS
Cytogenetic Map	5	q22	UniSTS

PMC20962P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	60,630,214 - 60,630,421 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	61,954,737 - 61,954,943	NCBI	Rnor6.0
Rnor_5.0	5	66,468,077 - 66,468,283	UniSTS	Rnor5.0
RGSC_v3.4	5	62,905,398 - 62,905,604	UniSTS	RGSC3.4
Celera	5	59,189,651 - 59,189,857	UniSTS
Cytogenetic Map	5	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
11	4	22	91	27	33	6	42	6	6	139	78	5	76	41	57	27	4	4

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_138909	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Y11321	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000012637 ⟹ ENSRNOP00000012637

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	65,425,630 - 65,428,438 (+)	Ensembl
mRatBN7.2 Ensembl	5	60,630,027 - 60,632,835 (+)	Ensembl
Rnor_6.0 Ensembl	5	61,954,549 - 61,957,357 (+)	Ensembl

RefSeq Acc Id:

NM_138909 ⟹ NP_620264

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	65,425,630 - 65,428,438 (+)	NCBI
mRatBN7.2	5	60,630,027 - 60,632,835 (+)	NCBI
Rnor_6.0	5	61,954,549 - 61,957,357 (+)	NCBI
Rnor_5.0	5	66,467,889 - 66,470,697 (+)	NCBI
RGSC_v3.4	5	62,905,210 - 62,908,018 (+)	RGD
Celera	5	59,189,463 - 59,192,271 (+)	RGD

Sequence:

show sequence

CTGGCGCCTTTAAGGAGGCGAAGCCAGCGGAGGGAGGAGCTGGCCCAGGTGTGTGCAGGAGAGC
GCCTCGCCGGCGGGACTCGGGGCTGGAGTCCAGGGCGGCAGAGCGGAGCAGTTGCTCGCCACCC
GGCCCGGCCCACTCGCCCGCCTCGCCACTGGCTTCGCCTCTCTGCCCTCCGCTTGGGCTGTATC
TTCACCGCAGAGGTGCGGCATGGGCGGCCACCGCAGGGGTGTACGTTTCCCCCACTGACTGCTC
CTGCACGAGACCCCAGCCCGCAGCCTCCTCTACGCGCACCGCCTCGACAGTCATCCTCCGACCC
GCAGGAACTCCCAAACAGTTGCCACCACCCGAGCCTCCGAGCCACCTCTGGACCCCCTGATCTC
TTGGCACCAGAACTTCAAGGACCCTCTGGCCCGTGCCCCGCAGGAGCCGTCGGTGGACGCCGCG
CTCCAGACCCCGAAGTCCCCTGCTCTCAGTGCTCTCCGTGCCAGCCGCGAAGCCCGGCAGAGTC
GGCTCTCGGGGTTCGGGATCTGGGGCCGGCGCGGCCGTCCGCAGCTGCAGACGACGGGGGGTAC
GGGGGACCGCGGCGCCATGACAGCCGAGAGCGCGCCGCCGCCCCCGCCGCAGCCCGAGGCGCTG
GCGGCCGTGAAGGAAGAGCGCGGTGAGGCGGCGGCGGGCGCGGGGGTCCCGGCGGAGGTGGCGG
GTCGCGGCGCCGGAGGACGGCGACGCAAGCGCCCCCTGCAGCGGGGGAAGCCGCCGTACAGCTA
CATCGCACTCATCGCGATGGCTATCGCGCACGCGCCCGAGCGCCGCCTGACTCTGGGCGGCATC
TACAAGTTCATCACCGAGCGCTTCCCGTTCTACCGCGACAACCCCAAGAAGTGGCAGAACAGCA
TCCGCCACAACCTCACCCTCAACGACTGCTTCCTCAAGATCCCGCGCGAGGCGGGCCGCCCGGG
CAAAGGCAACTACTGGGCGCTCGACCCCAACGCCGAGGACATGTTCGAGAGCGGCAGCTTCCTG
CGCCGGCGCAAGCGCTTCAAGCGCTCGGACCTGTCCACCTACCCGGCGTACATGCATGATGCAG
CCGCTGCTGCCGCCGCCGCCGCCGCCGCCATCTTCCCGGGTGCCGTGCCTGCCGCGAGGCCGGC
CTACCCGGGAGCCGTCTATGCGGGCTACGCGCCGCCGCTCGCCGCACCCCCGCCGGTCTACTAC
CCCGCAGCGTCGCCCGGGCCCTGCCGGGTCTTCGGCTTGGTTCCCGAGCGGCCGCTCAGCCCGG
ATCTGGGCCCCGCACCATCAGCAGCCGGAGGTTCGTGCGCCTTCGCGGCTGCGGCGGGCGCGCC
GGGCACAGGGAGCTTCCAGCCCGCGGTATGCACGGGCGCGCGGCCGGTCAACCCGGCTGCCTAT
GCCGCTGCCTACGCGGGCCCCGACGGCGCGTACCCGCAAGGGGCGAGCAGCGCGCTCTTCGCCG
CTGCTGCGGGCCGTCTGGCCGGACCCACTTCGCCCACCGCGGGAGGAGGCAGCGGCGGCGTGGA
GGCCACGGTGGACTTCTACGGGCGCACGTCTCCTGGCCAGTTCGGAGCGGCGCTGGGGCCCTGC
TATAATCCCAGTGGGCAACTCGGAGCCGGTGGTGGAGGTGCCTATCACTCCCGCCACGCCACCG
CCTACCCGGGCGCGGTGGATCGGTTCGTGTCTGCCATGTGAGCCGGGGGTAGGCACAAAACCTC
ACTGACTCCGGCACGTTCTGAAAGATGTAAATCCCCCGGAACCGGTGGACAGGACTAAAAGAGT
ATCGGACTGAGACTCACGAGTGTGCGAGGGCTCCGAGGGTCGCGGAGGCTCGGTGTCTTGCCCT
GTTCACAGACCGGATTTGCTTTGGACGTGGGCGGACGTAGGGAGGCCATAGCCACGTTTGGGCT
GACACAGGGGACCCTCGATGATGCGAAGCTCCAAAGAGCATGCCTTTCCGCCATTCTACTAGGG
AGGGCCCTAGCTGTAAAGGGTGGAGTGTTGCGTTGTTGCCCGCACCAGAATCTAGAATCCTGAA
CTGTGGTGGAGTCGTTTGGCTTCAGCGTGTGCTATGCTGGGCTAAACTCGGGCTTTTTACACGT
TCGCCTCTTAACTTTTGACTACCGTACCCCAAATAAAAGGCTCGGACAGTGCCTTTATAATTAA
AGTGAGAGCAAGTTTGCAAAAAGAGTTGCTTTTTAAAAATTAGTTCGGTTCAGCTGGGTTAGTT
TTCCCTGCCTCTGAGAGTCACAAGCCTGGGTCGCAATCGTAACTGAATTCTCGGTGTGATCCAG
CCCTAACACCTGAATTTTGAGTCTGTCTGTTATACAGAACTGTGCGATTCCGCCGTCTCATTTT
TAAACCCCCTCCCATTATCTTGGGTGCCAACCTTCCATATTTGGCAGCATTGGTCAACCACCTA
GGGCTTCCCAGTAGCCATGACAGAAGGCCATCCAGGAATGGGAACAGAACATTGGCAAGTATTT
AACCCAAAGTTTTAGGACTGGCTCCAAGTAGAGATTGTGCTTAATTATTGATTTTTTTTTTTTG
TTGTTGTTGTTTTGAGAGAGAGAGAGAGATTGGTCAGGCCGCAGCAGTGACTACCCAGTCAAAA
ATCTGATTTTCTGATAAGAATGTAGGTGGGGAGACTTTCCTTAACTGGGGCTTGTCTGTTCTGT
TTCCTGTGCGCTCCTTCTTCGGCGCCCTCCTCGAACAAAAAGGAAAAGTAATAAATTAGATGGT
TAACAAAGAGATCTTTTTTTAATTTTTTATTTCATTCTGTATCTTGTTTGTTTTG

hide sequence

Protein Sequences


Protein RefSeqs	NP_620264	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAA72174	(Get FASTA)	NCBI Sequence Viewer
	EDL98835	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000012637
	ENSRNOP00000012637.2

RefSeq Acc Id:

NP_620264 ⟸ NM_138909

- UniProtKB:

O08771 (UniProtKB/TrEMBL), A6IJB5 (UniProtKB/TrEMBL), F7EPL4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTAESAPPPPPQPEALAAVKEERGEAAAGAGVPAEVAGRGAGGRRRKRPLQRGKPPYSYIALIA
MAIAHAPERRLTLGGIYKFITERFPFYRDNPKKWQNSIRHNLTLNDCFLKIPREAGRPGKGNYW
ALDPNAEDMFESGSFLRRRKRFKRSDLSTYPAYMHDAAAAAAAAAAAIFPGAVPAARPAYPGAV
YAGYAPPLAAPPPVYYPAASPGPCRVFGLVPERPLSPDLGPAPSAAGGSCAFAAAAGAPGTGSF
QPAVCTGARPVNPAAYAAAYAGPDGAYPQGASSALFAAAAGRLAGPTSPTAGGGSGGVEATVDF
YGRTSPGQFGAALGPCYNPSGQLGAGGGGAYHSRHATAYPGAVDRFVSAM

hide sequence

Ensembl Acc Id:

ENSRNOP00000012637 ⟸ ENSRNOT00000012637

Protein Domains

Fork-head

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O08771-F1-model_v2	AlphaFold	O08771	1-370	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621723	AgrOrtholog
BioCyc Gene	G2FUF-41412	BioCyc
Ensembl Genes	ENSRNOG00000023497	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000012637	ENTREZGENE
	ENSRNOT00000012637.5	UniProtKB/TrEMBL
Gene3D-CATH	1.10.10.10	UniProtKB/TrEMBL
InterPro	FOX_domain-containing	UniProtKB/TrEMBL
	TF_fork_head	UniProtKB/TrEMBL
	TF_fork_head_CS	UniProtKB/TrEMBL
	TF_fork_head_CS_2	UniProtKB/TrEMBL
	WH-like_DNA-bd_sf	UniProtKB/TrEMBL
	WH_DNA-bd_sf	UniProtKB/TrEMBL
KEGG Report	rno:192274	UniProtKB/TrEMBL
NCBI Gene	192274	ENTREZGENE
PANTHER	FORKHEAD BOX PROTEIN	UniProtKB/TrEMBL
	FORKHEAD BOX PROTEIN E1	UniProtKB/TrEMBL
Pfam	Fork_head	UniProtKB/TrEMBL
PhenoGen	Foxe1	PhenoGen
PRINTS	FORKHEAD	UniProtKB/TrEMBL
PROSITE	FORK_HEAD_1	UniProtKB/TrEMBL
	FORK_HEAD_2	UniProtKB/TrEMBL
	FORK_HEAD_3	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000023497	RatGTEx
SMART	SM00339	UniProtKB/TrEMBL
Superfamily-SCOP	SSF46785	UniProtKB/TrEMBL
UniProt	A6IJB5	ENTREZGENE, UniProtKB/TrEMBL
	F7EPL4	ENTREZGENE, UniProtKB/TrEMBL
	O08771	ENTREZGENE
UniProt Secondary	O08771	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2014-12-29	Foxe1	forkhead box E1	Foxe1	forkhead box E1 (thyroid transcription factor 2)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-02-26	Foxe1	forkhead box E1 (thyroid transcription factor 2)			Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Foxe1	forkhead box E1 (thyroid transcription factor 2)			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in the endodermal lining of the foregut to the ectoderm which develops into the anterior pituitary	632682
gene_process	activates the expression of thyroglobulin (Tg) and thyroperoxidase (TPO) genes in thyroid follicular cells	632682
gene_protein	a DNA binding protein which has a forkhead domain-containing protein

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM