Symbol:
Vdac2
Name:
voltage-dependent anion channel 2
RGD ID:
621576
Description:
Predicted to enable several functions, including phosphatidylcholine binding activity; phospholipid scramblase activity; and sterol binding activity. Predicted to be involved in several processes, including binding activity of sperm to zona pellucida; mitochondrial outer membrane permeabilization; and negative regulation of intrinsic apoptotic signaling pathway. Located in synaptic vesicle. Used to study myocardial infarction. Biomarker of temporal lobe epilepsy. Orthologous to human VDAC2 (voltage dependent anion channel 2); PARTICIPATES IN calcium/calcium-mediated signaling pathway; Huntington's disease pathway; Parkinson's disease pathway; INTERACTS WITH 1,2,4-trimethylbenzene; 2,2,2-tetramine; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
B36-VDAC; non-selective voltage-gated ion channel VDAC2; outer mitochondrial membrane protein porin 2; VDAC-2; voltage-dependent anion-selective channel protein 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
VDAC2 (voltage dependent anion channel 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Vdac2 (voltage-dependent anion channel 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Vdac2 (voltage dependent anion channel 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
VDAC2 (voltage dependent anion channel 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
VDAC2 (voltage dependent anion channel 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Vdac2 (voltage dependent anion channel 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
VDAC2 (voltage dependent anion channel 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
VDAC2 (voltage dependent anion channel 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Vdac2 (voltage dependent anion channel 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
TEDDM1 (transmembrane epididymal protein 1) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
VDAC2 (voltage dependent anion channel 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Vdac2 (voltage-dependent anion channel 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
vdac2 (voltage-dependent anion channel 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
POR1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
POR2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
vdac-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Porin2
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
porin
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
vdac2
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 2,512,214 - 2,526,105 (-) NCBI GRCr8 mRatBN7.2 15 2,462,877 - 2,476,802 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 2,463,056 - 2,476,553 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 2,470,328 - 2,484,006 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 3,856,774 - 3,870,452 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 2,469,123 - 2,482,800 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 2,634,622 - 2,648,548 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 2,634,624 - 2,648,551 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 2,615,635 - 2,629,561 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 2,515,297 - 2,528,969 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 2,515,298 - 2,528,969 (-) NCBI Celera 15 2,105,517 - 2,119,199 (+) NCBI Celera Cytogenetic Map 15 p16 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Vdac2 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO VDAC2 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of VDAC2 mRNA CTD PMID:22079256 Vdac2 Rat 1,2,4-trimethylbenzene decreases expression EXP 6480464 pseudocumene results in decreased expression of VDAC2 protein CTD PMID:17337753 Vdac2 Rat 1,2-dimethylhydrazine decreases expression ISO Vdac2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of VDAC2 mRNA CTD PMID:22206623 Vdac2 Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO Vdac2 (Mus musculus) 6480464 [Flame Retardants results in increased abundance of 2 more ... CTD PMID:38995820 Vdac2 Rat 2,2,2-tetramine multiple interactions EXP 6480464 Trientine inhibits the reaction [Streptozocin results in increased expression of VDAC2 protein] CTD PMID:19634143 Vdac2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Vdac2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of VDAC2 mRNA CTD PMID:21570461 Vdac2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of VDAC2 mRNA CTD PMID:34747641 Vdac2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of VDAC2 protein CTD PMID:17998243 Vdac2 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of VDAC2 mRNA CTD PMID:21346803 Vdac2 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO VDAC2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of VDAC2 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of VDAC2 mRNA CTD PMID:28628672 Vdac2 Rat 4,4'-diisothiocyano-trans-stilbene-2,2'-disulfonic acid multiple interactions ISO VDAC2 (Homo sapiens) 6480464 4 more ... CTD PMID:29229420 Vdac2 Rat 4,4'-sulfonyldiphenol increases expression ISO Vdac2 (Mus musculus) 6480464 bisphenol S results in increased expression of VDAC2 mRNA CTD PMID:39298647 Vdac2 Rat 4,4'-sulfonyldiphenol increases expression ISO VDAC2 (Homo sapiens) 6480464 bisphenol S results in increased expression of VDAC2 protein CTD PMID:34186270 Vdac2 Rat 4,4'-sulfonyldiphenol multiple interactions ISO VDAC2 (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of VDAC2 gene CTD PMID:31601247 Vdac2 Rat 4-hydroxynon-2-enal affects binding ISO VDAC2 (Homo sapiens) 6480464 VDAC2 protein binds to 4-hydroxy-2-nonenal CTD PMID:20043646 Vdac2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of VDAC2 mRNA CTD PMID:30047161 Vdac2 Rat aconitine decreases expression EXP 6480464 Aconitine results in decreased expression of VDAC2 protein CTD PMID:33236894 Vdac2 Rat all-trans-retinoic acid decreases expression ISO Vdac2 (Mus musculus) 6480464 Tretinoin results in decreased expression of VDAC2 mRNA CTD PMID:16604517 Vdac2 Rat all-trans-retinoic acid decreases expression ISO VDAC2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of VDAC2 mRNA CTD PMID:33167477 Vdac2 Rat amiodarone increases expression ISO Vdac2 (Mus musculus) 6480464 Amiodarone results in increased expression of VDAC2 mRNA CTD PMID:24489787 Vdac2 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of VDAC2 mRNA CTD PMID:30047161 Vdac2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of VDAC2 mRNA CTD PMID:16483693 Vdac2 Rat Aroclor 1254 decreases expression ISO Vdac2 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of VDAC2 mRNA CTD PMID:23650126 Vdac2 Rat arsenite(3-) multiple interactions ISO VDAC2 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to VDAC2 protein] CTD PMID:32406909 Vdac2 Rat arsenous acid increases expression ISO VDAC2 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of VDAC2 mRNA CTD PMID:20458559 Vdac2 Rat atrazine decreases expression ISO VDAC2 (Homo sapiens) 6480464 Atrazine results in decreased expression of VDAC2 mRNA CTD PMID:22378314 Vdac2 Rat benzo[a]pyrene increases expression ISO Vdac2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of VDAC2 mRNA CTD PMID:22228805 Vdac2 Rat beta-lapachone increases expression ISO VDAC2 (Homo sapiens) 6480464 beta-lapachone results in increased expression of VDAC2 mRNA CTD PMID:38218311 Vdac2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Vdac2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of VDAC2 mRNA CTD PMID:33754040 Vdac2 Rat bisphenol A decreases expression ISO Vdac2 (Mus musculus) 6480464 bisphenol A results in decreased expression of VDAC2 mRNA and bisphenol A results in decreased expression of VDAC2 protein CTD PMID:24909818 and PMID:33221593 Vdac2 Rat bisphenol A increases expression ISO VDAC2 (Homo sapiens) 6480464 bisphenol A results in increased expression of VDAC2 protein CTD PMID:37567409 Vdac2 Rat bisphenol A multiple interactions ISO VDAC2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of VDAC2 mRNA CTD PMID:28628672 Vdac2 Rat bisphenol A increases expression ISO Vdac2 (Mus musculus) 6480464 bisphenol A results in increased expression of VDAC2 protein CTD PMID:24909818 Vdac2 Rat bisphenol AF increases expression ISO VDAC2 (Homo sapiens) 6480464 bisphenol AF results in increased expression of VDAC2 protein CTD PMID:34186270 Vdac2 Rat Bisphenol B increases expression ISO VDAC2 (Homo sapiens) 6480464 bisphenol B results in increased expression of VDAC2 protein CTD PMID:34186270 Vdac2 Rat bisphenol F multiple interactions ISO VDAC2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of VDAC2 mRNA CTD PMID:28628672 Vdac2 Rat bisphenol F increases expression ISO VDAC2 (Homo sapiens) 6480464 bisphenol F results in increased expression of VDAC2 protein CTD PMID:34186270 Vdac2 Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of VDAC2 protein CTD PMID:28903499 Vdac2 Rat cadmium atom multiple interactions ISO VDAC2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of VDAC2 protein CTD PMID:33040242 Vdac2 Rat cadmium atom multiple interactions ISO Vdac2 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of VDAC2 protein more ... CTD PMID:32199951 Vdac2 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of VDAC2 promoter CTD PMID:22457795 Vdac2 Rat cadmium dichloride multiple interactions ISO Vdac2 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of VDAC2 protein more ... CTD PMID:32199951 Vdac2 Rat cadmium dichloride multiple interactions ISO VDAC2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of VDAC2 protein CTD PMID:33040242 Vdac2 Rat clobetasol increases expression ISO Vdac2 (Mus musculus) 6480464 Clobetasol results in increased expression of VDAC2 mRNA CTD PMID:27462272 Vdac2 Rat copper(II) chloride increases expression ISO Vdac2 (Mus musculus) 6480464 cupric chloride results in increased expression of VDAC2 protein CTD PMID:29617964 Vdac2 Rat cyclosporin A increases expression ISO Vdac2 (Mus musculus) 6480464 Cyclosporine results in increased expression of VDAC2 protein CTD PMID:25047351 Vdac2 Rat deguelin increases expression ISO VDAC2 (Homo sapiens) 6480464 deguelin results in increased expression of VDAC2 mRNA CTD PMID:33512557 Vdac2 Rat desferrioxamine B multiple interactions ISO VDAC2 (Homo sapiens) 6480464 ferric ammonium citrate inhibits the reaction [Deferoxamine results in increased expression of VDAC2 protein] CTD PMID:19515424 Vdac2 Rat desferrioxamine B decreases expression ISO VDAC2 (Homo sapiens) 6480464 Deferoxamine results in decreased expression of VDAC2 protein CTD PMID:19515424 Vdac2 Rat dexamethasone multiple interactions ISO VDAC2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of VDAC2 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of VDAC2 mRNA CTD PMID:28628672 Vdac2 Rat diallyl trisulfide decreases expression ISO VDAC2 (Homo sapiens) 6480464 diallyl trisulfide results in decreased expression of VDAC2 protein CTD PMID:16344271 Vdac2 Rat diarsenic trioxide increases expression ISO VDAC2 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of VDAC2 mRNA CTD PMID:20458559 Vdac2 Rat dibutyl phthalate increases expression ISO Vdac2 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of VDAC2 mRNA CTD PMID:17361019 and PMID:21266533 Vdac2 Rat diquat increases expression ISO VDAC2 (Homo sapiens) 6480464 Diquat results in increased expression of VDAC2 protein CTD PMID:38128689 Vdac2 Rat disodium selenite increases expression ISO VDAC2 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of VDAC2 mRNA CTD PMID:18175754 Vdac2 Rat dopamine affects expression ISO VDAC2 (Homo sapiens) 6480464 Dopamine affects the expression of VDAC2 protein CTD PMID:24675778 Vdac2 Rat doxorubicin decreases expression ISO Vdac2 (Mus musculus) 6480464 Doxorubicin results in decreased expression of VDAC2 mRNA CTD PMID:26873546 Vdac2 Rat enzyme inhibitor multiple interactions ISO VDAC2 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of VDAC2 protein CTD PMID:23301498 Vdac2 Rat erastin decreases expression ISO VDAC2 (Homo sapiens) 6480464 erastin results in decreased expression of VDAC2 protein CTD PMID:17568748 Vdac2 Rat erastin increases degradation EXP 6480464 erastin results in increased degradation of VDAC2 protein CTD PMID:32937103 Vdac2 Rat erastin affects binding ISO VDAC2 (Homo sapiens) 6480464 erastin analog binds to VDAC2 protein CTD PMID:17568748 Vdac2 Rat ethanol affects splicing ISO Vdac2 (Mus musculus) 6480464 Ethanol affects the splicing of VDAC2 mRNA CTD PMID:30319688 Vdac2 Rat ethanol multiple interactions ISO VDAC2 (Homo sapiens) 6480464 [CYP2E1 protein affects the susceptibility to Ethanol] which affects the expression of VDAC2 protein and FXN protein affects the reaction [[CYP2E1 protein affects the susceptibility to Ethanol] which affects the expression of VDAC2 protein] CTD PMID:33017621 Vdac2 Rat ethanol increases expression ISO Vdac2 (Mus musculus) 6480464 Ethanol results in increased expression of VDAC2 protein CTD PMID:33017621 Vdac2 Rat fenthion decreases expression ISO Vdac2 (Mus musculus) 6480464 Fenthion results in decreased expression of VDAC2 mRNA CTD PMID:34813904 Vdac2 Rat fenvalerate decreases expression EXP 6480464 fenvalerate results in decreased expression of VDAC2 protein CTD PMID:33656234 Vdac2 Rat ferric ammonium citrate multiple interactions ISO VDAC2 (Homo sapiens) 6480464 ferric ammonium citrate inhibits the reaction [Deferoxamine results in increased expression of VDAC2 protein] CTD PMID:19515424 Vdac2 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of VDAC2 mRNA CTD PMID:24136188 Vdac2 Rat FR900359 increases phosphorylation ISO VDAC2 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of VDAC2 protein CTD PMID:37730182 Vdac2 Rat fulvestrant multiple interactions ISO VDAC2 (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of VDAC2 gene CTD PMID:31601247 Vdac2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of VDAC2 mRNA CTD PMID:22061828 Vdac2 Rat hydrogen peroxide multiple interactions ISO VDAC2 (Homo sapiens) 6480464 [Hydrogen Peroxide promotes the reaction [VDAC2 protein binds to VDAC2 protein]] which affects the localization of VDAC2 and Hydrogen Peroxide promotes the reaction [VDAC2 protein binds to VDAC2 protein] CTD PMID:29229420 Vdac2 Rat indometacin multiple interactions ISO VDAC2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of VDAC2 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of VDAC2 mRNA CTD PMID:28628672 Vdac2 Rat ivermectin decreases expression ISO VDAC2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of VDAC2 protein CTD PMID:32959892 Vdac2 Rat josamycin affects response to substance ISO VDAC2 (Homo sapiens) 6480464 VDAC2 protein affects the susceptibility to Josamycin CTD PMID:31915244 Vdac2 Rat ketamine increases expression EXP 6480464 Ketamine results in increased expression of VDAC2 protein CTD PMID:18504422 Vdac2 Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of VDAC2 protein CTD PMID:19826936 Vdac2 Rat methidathion decreases expression ISO Vdac2 (Mus musculus) 6480464 methidathion results in decreased expression of VDAC2 mRNA CTD PMID:34813904 Vdac2 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of VDAC2 mRNA CTD PMID:30047161 Vdac2 Rat N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine decreases expression EXP 6480464 N more ... CTD PMID:21605504 Vdac2 Rat N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine multiple interactions EXP 6480464 Zinc Sulfate inhibits the reaction [N more ... CTD PMID:21605504 Vdac2 Rat N-acetyl-L-cysteine multiple interactions ISO VDAC2 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [quinocetone promotes the reaction [VDAC2 protein binds to VDAC2 protein]] CTD PMID:29229420 Vdac2 Rat N-methyl-4-phenylpyridinium increases expression ISO VDAC2 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of VDAC2 protein CTD PMID:24675778 Vdac2 Rat N-methyl-D-aspartic acid multiple interactions ISO Vdac2 (Mus musculus) 6480464 N-Methylaspartate inhibits the reaction [gelsenicine results in increased phosphorylation of VDAC2 protein] CTD PMID:34389372 Vdac2 Rat N-nitrosomorpholine increases expression EXP 6480464 N-nitrosomorpholine results in increased expression of VDAC2 protein CTD PMID:19716841 Vdac2 Rat p-menthan-3-ol increases expression ISO VDAC2 (Homo sapiens) 6480464 Menthol results in increased expression of VDAC2 mRNA CTD PMID:26760959 Vdac2 Rat paracetamol affects expression ISO Vdac2 (Mus musculus) 6480464 Acetaminophen affects the expression of VDAC2 mRNA CTD PMID:17562736 Vdac2 Rat paraquat increases expression ISO VDAC2 (Homo sapiens) 6480464 Paraquat results in increased expression of VDAC2 protein CTD PMID:34064677 Vdac2 Rat perfluorohexanesulfonic acid increases expression ISO Vdac2 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of VDAC2 mRNA CTD PMID:37995155 Vdac2 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of VDAC2 mRNA CTD PMID:12082028 and PMID:30047161 Vdac2 Rat phenobarbital affects expression ISO VDAC2 (Homo sapiens) 6480464 Phenobarbital affects the expression of VDAC2 mRNA CTD PMID:19159669 Vdac2 Rat picoxystrobin increases expression ISO VDAC2 (Homo sapiens) 6480464 picoxystrobin results in increased expression of VDAC2 mRNA CTD PMID:33512557 Vdac2 Rat potassium chromate increases expression ISO VDAC2 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of VDAC2 mRNA CTD PMID:22079256 Vdac2 Rat potassium chromate multiple interactions ISO VDAC2 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of VDAC2 mRNA CTD PMID:22079256 Vdac2 Rat quercetin decreases expression ISO VDAC2 (Homo sapiens) 6480464 Quercetin results in decreased expression of VDAC2 protein CTD PMID:14750173 Vdac2 Rat reactive oxygen species multiple interactions ISO VDAC2 (Homo sapiens) 6480464 VDAC2 inhibits the reaction [ME-344 results in increased abundance of Reactive Oxygen Species] CTD PMID:32546528 Vdac2 Rat rotenone increases expression ISO VDAC2 (Homo sapiens) 6480464 Rotenone results in increased expression of VDAC2 mRNA CTD PMID:33512557 Vdac2 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of VDAC2 protein CTD PMID:35544339 Vdac2 Rat sodium arsenite increases expression ISO Vdac2 (Mus musculus) 6480464 sodium arsenite results in increased expression of VDAC2 protein CTD PMID:29044176 Vdac2 Rat sodium arsenite increases expression ISO VDAC2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of VDAC2 mRNA CTD PMID:38568856 Vdac2 Rat sodium fluoride increases expression ISO Vdac2 (Mus musculus) 6480464 Sodium Fluoride results in increased expression of VDAC2 protein CTD PMID:28918527 Vdac2 Rat sodium fluoride decreases expression EXP 6480464 Sodium Fluoride results in decreased expression of VDAC2 protein CTD PMID:29653260 Vdac2 Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of VDAC2 protein CTD PMID:19634143 Vdac2 Rat streptozocin multiple interactions EXP 6480464 Trientine inhibits the reaction [Streptozocin results in increased expression of VDAC2 protein] CTD PMID:19634143 Vdac2 Rat T-2 toxin increases expression ISO VDAC2 (Homo sapiens) 6480464 T-2 Toxin results in increased expression of VDAC2 protein CTD PMID:34581912 Vdac2 Rat tert-butyl hydroperoxide increases expression ISO VDAC2 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of VDAC2 mRNA CTD PMID:15336504 Vdac2 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of VDAC2 mRNA CTD PMID:16644059 Vdac2 Rat titanium dioxide decreases methylation ISO Vdac2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of VDAC2 gene and titanium dioxide results in decreased methylation of VDAC2 promoter CTD PMID:35295148 Vdac2 Rat tolcapone affects binding EXP 6480464 tolcapone binds to VDAC2 protein CTD PMID:19783845 Vdac2 Rat triphenyl phosphate affects expression ISO VDAC2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of VDAC2 mRNA CTD PMID:37042841 Vdac2 Rat uranium atom affects expression ISO VDAC2 (Homo sapiens) 6480464 Uranium affects the expression of VDAC2 mRNA CTD PMID:15672453 Vdac2 Rat valproic acid affects expression ISO Vdac2 (Mus musculus) 6480464 Valproic Acid affects the expression of VDAC2 mRNA CTD PMID:17292431 Vdac2 Rat vanadium atom increases expression ISO VDAC2 (Homo sapiens) 6480464 Vanadium results in increased expression of VDAC2 mRNA CTD PMID:19000753 Vdac2 Rat vanadium(0) increases expression ISO VDAC2 (Homo sapiens) 6480464 Vanadium results in increased expression of VDAC2 mRNA CTD PMID:19000753 Vdac2 Rat zinc sulfate multiple interactions EXP 6480464 Zinc Sulfate inhibits the reaction [N more ... CTD PMID:21605504
Imported Annotations - KEGG (archival)
(-)-epigallocatechin 3-gallate (ISO) 1,2,4-trimethylbenzene (EXP) 1,2-dimethylhydrazine (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2,2-tetramine (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dinitrotoluene (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diisothiocyano-trans-stilbene-2,2'-disulfonic acid (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) 6-propyl-2-thiouracil (EXP) aconitine (EXP) all-trans-retinoic acid (ISO) amiodarone (ISO) amitrole (EXP) ammonium chloride (EXP) Aroclor 1254 (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) Brodifacoum (EXP) cadmium atom (ISO) cadmium dichloride (EXP,ISO) clobetasol (ISO) copper(II) chloride (ISO) cyclosporin A (ISO) deguelin (ISO) desferrioxamine B (ISO) dexamethasone (ISO) diallyl trisulfide (ISO) diarsenic trioxide (ISO) dibutyl phthalate (ISO) diquat (ISO) disodium selenite (ISO) dopamine (ISO) doxorubicin (ISO) enzyme inhibitor (ISO) erastin (EXP,ISO) ethanol (ISO) fenthion (ISO) fenvalerate (EXP) ferric ammonium citrate (ISO) flutamide (EXP) FR900359 (ISO) fulvestrant (ISO) gentamycin (EXP) hydrogen peroxide (ISO) indometacin (ISO) ivermectin (ISO) josamycin (ISO) ketamine (EXP) methamphetamine (EXP) methidathion (ISO) methimazole (EXP) N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (EXP) N-acetyl-L-cysteine (ISO) N-methyl-4-phenylpyridinium (ISO) N-methyl-D-aspartic acid (ISO) N-nitrosomorpholine (EXP) p-menthan-3-ol (ISO) paracetamol (ISO) paraquat (ISO) perfluorohexanesulfonic acid (ISO) phenobarbital (EXP,ISO) picoxystrobin (ISO) potassium chromate (ISO) quercetin (ISO) reactive oxygen species (ISO) rotenone (EXP,ISO) sodium arsenite (ISO) sodium fluoride (EXP,ISO) streptozocin (EXP) T-2 toxin (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP) titanium dioxide (ISO) tolcapone (EXP) triphenyl phosphate (ISO) uranium atom (ISO) valproic acid (ISO) vanadium atom (ISO) vanadium(0) (ISO) zinc sulfate (EXP)
1.
Proteomic analysis reveals late exercise effects on cardiac remodeling following myocardial infarction.
Bansal A, etal., J Proteomics. 2010 Sep 10;73(10):2041-9. doi: 10.1016/j.jprot.2010.06.009. Epub 2010 Jul 1.
2.
All three isoforms of the voltage-dependent anion channel (VDAC1, VDAC2, and VDAC3) are present in mitochondria from bovine, rabbit, and rat brain.
Cesar Mde C and Wilson JE, Arch Biochem Biophys. 2004 Feb 15;422(2):191-6.
3.
[Voltage dependent anion channel 2 involved mitochondrial apoptosis and its possible regulatory signal pathway in hearts of rats with severe scalds].
Feng YQ, etal., Zhonghua Yi Xue Za Zhi. 2013 Mar 26;93(12):939-43.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Preliminary explorations of the role of mitochondrial proteins in refractory epilepsy: some findings from comparative proteomics.
Jiang W, etal., J Neurosci Res. 2007 Nov 1;85(14):3160-70.
7.
Comparative proteomics and correlated signaling network of rat hippocampus in the pilocarpine model of temporal lobe epilepsy.
Liu XY, etal., Proteomics. 2008 Feb;8(3):582-603. doi: 10.1002/pmic.200700514.
8.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
9.
The proteome of the presynaptic active zone: from docked synaptic vesicles to adhesion molecules and maxi-channels.
Morciano M, etal., J Neurochem. 2009 Feb;108(3):662-75. doi: 10.1111/j.1471-4159.2008.05824.x.
10.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
12.
GOA pipeline
RGD automated data pipeline
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Comprehensive gene review and curation
RGD comprehensive gene curation
15.
Characterization of porin isoforms expressed in tumor cells.
Shinohara Y, etal., Eur J Biochem 2000 Oct;267(19):6067-73.
16.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Vdac2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 2,512,214 - 2,526,105 (-) NCBI GRCr8 mRatBN7.2 15 2,462,877 - 2,476,802 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 2,463,056 - 2,476,553 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 2,470,328 - 2,484,006 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 3,856,774 - 3,870,452 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 2,469,123 - 2,482,800 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 2,634,622 - 2,648,548 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 2,634,624 - 2,648,551 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 2,615,635 - 2,629,561 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 2,515,297 - 2,528,969 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 2,515,298 - 2,528,969 (-) NCBI Celera 15 2,105,517 - 2,119,199 (+) NCBI Celera Cytogenetic Map 15 p16 NCBI
VDAC2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 75,210,170 - 75,231,448 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 75,210,154 - 75,231,448 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 76,969,928 - 76,991,206 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 76,640,569 - 76,661,212 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 76,640,568 - 76,661,210 NCBI Celera 10 70,258,168 - 70,279,465 (+) NCBI Celera Cytogenetic Map 10 q22.2 NCBI HuRef 10 70,968,331 - 70,989,598 (+) NCBI HuRef CHM1_1 10 77,251,734 - 77,273,028 (+) NCBI CHM1_1 T2T-CHM13v2.0 10 76,083,655 - 76,104,942 (+) NCBI T2T-CHM13v2.0
Vdac2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 21,881,629 - 21,895,947 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 21,875,306 - 21,895,947 (+) Ensembl GRCm39 Ensembl GRCm38 14 21,831,561 - 21,845,879 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 21,825,238 - 21,845,879 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 22,650,783 - 22,665,101 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 20,620,113 - 20,634,431 (+) NCBI MGSCv36 mm8 Celera 14 18,214,291 - 18,228,576 (+) NCBI Celera Cytogenetic Map 14 A3 NCBI cM Map 14 11.91 NCBI
Vdac2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955437 16,853,433 - 16,872,345 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955437 16,857,715 - 16,871,717 (-) NCBI ChiLan1.0 ChiLan1.0
VDAC2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 87,366,329 - 87,391,550 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 87,372,155 - 87,397,048 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 71,739,395 - 71,763,835 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 74,403,221 - 74,411,762 (+) NCBI panpan1.1 PanPan1.1 panPan2
VDAC2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 25,449,926 - 25,462,147 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 25,449,442 - 25,462,335 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 25,585,079 - 25,597,491 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 25,732,572 - 25,744,990 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 4 25,732,597 - 25,753,031 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 4 25,627,631 - 25,640,037 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 25,828,227 - 25,840,628 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 26,184,477 - 26,196,904 (+) NCBI UU_Cfam_GSD_1.0
Vdac2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 55,629,722 - 55,643,567 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936521 4,122,270 - 4,136,380 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936521 4,122,447 - 4,136,228 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
VDAC2
VDAC2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 56,141,153 - 56,160,378 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 56,136,756 - 56,157,173 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 16,628,451 - 16,649,525 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Vdac2
.
Predicted Target Of
Count of predictions: 92 Count of miRNA genes: 73 Interacting mature miRNAs: 86 Transcripts: ENSRNOT00000018462 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1641913 Colcr2 Colorectal carcinoma resistance QTL 2 6.57 0.0197 intestine integrity trait (VT:0010554) poorly differentiated malignant colorectal tumor number (CMO:0002076) 15 2266368 22711984 Rat 10401805 Kidm51 Kidney mass QTL 51 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 15 306329 45306329 Rat 5684946 Bss98 Bone structure and strength QTL 98 3.9 0.0026 tibia strength trait (VT:1000284) tibia ultimate force (CMO:0001734) 15 1058250 14481294 Rat 1354657 Despr13 Despair related QTL 13 0.0022 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 15 1 29912054 Rat 1641887 Alcrsp14 Alcohol response QTL 14 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 15 1 42356671 Rat 2298549 Neuinf12 Neuroinflammation QTL 12 3.5 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 15 1 55302115 Rat 731170 Pur3 Proteinuria QTL 3 2.3 0.0005 urine protein amount (VT:0005160) urine protein excretion rate (CMO:0000759) 15 1 41686771 Rat 8552920 Pigfal8 Plasma insulin-like growth factor 1 level QTL 8 3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 15 1 34723002 Rat 738017 Hcas7 Hepatocarcinoma susceptibility QTL 7 2.91 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 15 2266368 46921453 Rat 8694361 Abfw6 Abdominal fat weight QTL 6 10.2 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 15 1 34723002 Rat 9589149 Insul29 Insulin level QTL 29 9.06 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 15 1 34723002 Rat
RH135028
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 2,462,675 - 2,462,856 (+) MAPPER mRatBN7.2 Rnor_6.0 15 2,634,421 - 2,634,601 NCBI Rnor6.0 Rnor_5.0 15 2,615,434 - 2,615,614 UniSTS Rnor5.0 RGSC_v3.4 15 2,515,096 - 2,515,276 UniSTS RGSC3.4 Celera 15 2,119,220 - 2,119,400 UniSTS RH 3.4 Map 15 44.6 UniSTS Cytogenetic Map 15 p16 UniSTS
AA900297
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 2,463,295 - 2,463,434 (+) MAPPER mRatBN7.2 Rnor_6.0 15 2,635,041 - 2,635,179 NCBI Rnor6.0 Rnor_5.0 15 2,616,054 - 2,616,192 UniSTS Rnor5.0 RGSC_v3.4 15 2,515,716 - 2,515,854 UniSTS RGSC3.4 Celera 15 2,118,642 - 2,118,780 UniSTS RH 3.4 Map 15 46.3 UniSTS Cytogenetic Map 15 p16 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000018462 ⟹ ENSRNOP00000018462
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 2,467,361 - 2,476,553 (-) Ensembl Rnor_6.0 Ensembl 15 2,634,624 - 2,648,294 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000086864 ⟹ ENSRNOP00000074839
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 2,463,056 - 2,475,565 (-) Ensembl Rnor_6.0 Ensembl 15 2,634,800 - 2,648,551 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000110275 ⟹ ENSRNOP00000083875
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 2,463,056 - 2,476,063 (-) Ensembl
RefSeq Acc Id:
NM_031354 ⟹ NP_112644
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 2,512,214 - 2,525,886 (-) NCBI mRatBN7.2 15 2,462,877 - 2,476,548 (-) NCBI Rnor_6.0 15 2,634,622 - 2,648,294 (-) NCBI Rnor_5.0 15 2,615,635 - 2,629,561 (-) NCBI RGSC_v3.4 15 2,515,297 - 2,528,969 (-) RGD Celera 15 2,105,517 - 2,119,199 (+) RGD
Sequence:
GGGGAGGCCAGGCTTGCGGCGGGGCGCAACGGTGTCTCCTTCACTTCGCCCTCCAGCCGCGGTGGCTGCAGCGCAACTTCCAGATAGCGGAGTGGCCTCAGCTGCGAGCCGAGCGGTGGCGGCAGCGC
hide sequence
RefSeq Acc Id:
XM_006251661 ⟹ XP_006251723
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 2,512,393 - 2,526,105 (-) NCBI mRatBN7.2 15 2,463,052 - 2,476,802 (-) NCBI Rnor_6.0 15 2,634,801 - 2,648,548 (-) NCBI Rnor_5.0 15 2,615,635 - 2,629,561 (-) NCBI
Sequence:
CGCGGGTGCCGTTGCGCCGCCTCCGCCGTTCCCCGGTCCTCGCCTCTGGGGCTGCCCTGAACAT
hide sequence
RefSeq Acc Id:
NP_112644 ⟸ NM_031354
- UniProtKB:
Q9JI32 (UniProtKB/Swiss-Prot), P81155 (UniProtKB/Swiss-Prot), A0A8L2URG2 (UniProtKB/TrEMBL)
- Sequence:
MAECCVPVCQRPICIPPPYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVSGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKS
hide sequence
RefSeq Acc Id:
XP_006251723 ⟸ XM_006251661
- Peptide Label:
isoform X1
- UniProtKB:
Q9JI32 (UniProtKB/Swiss-Prot), P81155 (UniProtKB/Swiss-Prot), A0A8L2URG2 (UniProtKB/TrEMBL)
- Sequence:
MAECCVPVCQRPICIPPPYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTG
hide sequence
Ensembl Acc Id:
ENSRNOP00000018462 ⟸ ENSRNOT00000018462
Ensembl Acc Id:
ENSRNOP00000074839 ⟸ ENSRNOT00000086864
Ensembl Acc Id:
ENSRNOP00000083875 ⟸ ENSRNOT00000110275
RGD ID: 13699546 Promoter ID: EPDNEW_R10070 Type: initiation region Name: Vdac2_1 Description: voltage-dependent anion channel 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 15 2,648,259 - 2,648,319 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Vdac2
voltage-dependent anion channel 2
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Vdac2
voltage-dependent anion channel 2
Symbol and Name status set to provisional
70820 PROVISIONAL
