Advanced Search (OLGA)

Gene: Ccn3 (cellular communication network factor 3) Rattus norvegicus

Analyze

Symbol:

Ccn3

Name:

cellular communication network factor 3

RGD ID:

621553

Description:

Predicted to enable heparin binding activity and signaling receptor binding activity. Involved in cerebellum development; chondrocyte differentiation; and negative regulation of sensory perception of pain. Acts upstream of or within regulation of gene expression. Located in several cellular components, including dendrite; gap junction; and neuronal cell body. Orthologous to human CCN3 (cellular communication network factor 3); INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

CCN family member 3; nephroblastoma overexpressed; nephroblastoma overexpressed gene; nephroblastoma overexpressed gene protein homolog; nephroblastoma-overexpressed gene protein homolog; Nov; novH; protein NOV homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CCN3 (cellular communication network factor 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ccn3 (cellular communication network factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ccn3 (cellular communication network factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CCN3 (cellular communication network factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CCN3 (cellular communication network factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ccn3 (cellular communication network factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CCN3 (cellular communication network factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CCN3 (cellular communication network factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ccn3 (cellular communication network factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ccn3 (cellular communication network factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CCN3 (cellular communication network factor 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ccn3 (cellular communication network factor 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ccn	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ccn	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ccn3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ccn3	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	87,983,788 - 87,990,810 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	87,982,216 - 87,994,581 (+)	Ensembl				GRCr8
mRatBN7.2	7	86,094,000 - 86,101,022 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	86,094,000 - 86,101,019 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	87,980,947 - 87,987,976 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	90,182,154 - 90,189,181 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	89,987,634 - 89,994,661 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	94,375,134 - 94,382,154 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	94,375,020 - 94,383,024 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	95,015,159 - 95,022,179 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	91,162,676 - 91,169,696 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	82,897,053 - 82,904,052 (+)	NCBI		Celera
RGSC_v3.1	7	91,196,905 - 91,203,925 (+)	NCBI
Cytogenetic Map	7	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

COVID-19 (ISO)

long QT syndrome (ISO)

pre-eclampsia (ISO)

stomach cancer (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2-nitrotoluene (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3-methylcholanthrene (ISO)

4-hydroxyphenyl retinamide (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

7,12-dimethyltetraphene (EXP)

8-Br-cAMP (ISO)

acetamide (EXP)

actinomycin D (ISO)

afimoxifene (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

benzalkonium chloride (ISO)

benzo[a]pyrene (EXP,ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

bromochloroacetic acid (EXP)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

CGP 52608 (ISO)

chloroethene (ISO)

chlorpromazine (EXP)

cisplatin (ISO)

cocaine (EXP)

copper atom (EXP)

copper(0) (EXP)

corticosterone (EXP)

cycloheximide (ISO)

cyclosporin A (EXP,ISO)

D-mannitol (ISO)

dexamethasone (ISO)

diazepam (EXP)

diethylstilbestrol (EXP,ISO)

diuron (EXP)

dorsomorphin (ISO)

endosulfan (EXP)

ethanol (ISO)

fipronil (EXP)

flavonoids (EXP)

fluoxetine (EXP)

fulvestrant (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

indometacin (ISO)

iron dichloride (ISO)

isoflavones (ISO)

levonorgestrel (ISO)

lucanthone (ISO)

methylisothiazolinone (ISO)

N-methyl-N-nitrosourea (ISO)

N-nitrosodiethylamine (ISO)

nitrofen (EXP)

Nutlin-3 (ISO)

okadaic acid (ISO)

panobinostat (ISO)

paracetamol (EXP)

pentanal (ISO)

potassium chromate (ISO)

progesterone (ISO)

propanal (ISO)

raloxifene (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

Soman (EXP)

T-2 toxin (ISO)

tamoxifen (ISO)

temozolomide (ISO)

tert-butyl hydroperoxide (ISO)

testosterone undecanoate (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

angiogenesis (ISO,ISS)

bone regeneration (ISO,ISS)

cell adhesion (IBA)

cell adhesion mediated by integrin (ISO,ISS)

cell chemotaxis (ISO,ISS)

cerebellum development (IEP)

chondrocyte differentiation (IBA,IMP,ISO,ISS)

endothelial cell chemotaxis (ISO,ISS)

endothelial cell-cell adhesion (ISO,ISS)

fibroblast migration (ISO,ISS)

hematopoietic stem cell homeostasis (ISO)

negative regulation of cell growth (ISO,ISS)

negative regulation of chondrocyte proliferation (ISO,ISS)

negative regulation of inflammatory response (ISO,ISS)

negative regulation of insulin secretion (ISO,ISS)

negative regulation of monocyte chemotaxis (ISO,ISS)

negative regulation of myotube differentiation (ISO,ISS)

negative regulation of non-canonical NF-kappaB signal transduction (ISO,ISS)

negative regulation of sensory perception of pain (IMP)

negative regulation of SMAD protein signal transduction (ISO,ISS)

positive regulation of cell differentiation (IBA)

positive regulation of Notch signaling pathway (ISO,ISS)

positive regulation of ossification (ISO,ISS)

regulation of gene expression (IDA)

regulation of multicellular organismal process (IEA)

signal transduction (IBA,IEA)

smooth muscle cell migration (ISO,ISS)

smooth muscle cell proliferation (ISO,ISS)

type B pancreatic cell proliferation (ISO,ISS)

Cellular Component

axon (IDA)

cytoplasm (IDA,IEA,ISO)

cytosol (ISO)

dendrite (IDA)

extracellular matrix (IBA,IDA)

extracellular region (IDA,IEA,ISO)

extracellular space (IBA)

gap junction (IDA,IEA,ISO)

neuronal cell body (IDA)

Molecular Function

growth factor activity (IEA,TAS)

heparin binding (IBA)

hormone activity (IEA,ISO,ISS)

integrin binding (IBA,ISO)

Notch binding (ISO)

protein binding (ISO)

signaling receptor binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	CCN3 (NOV) interacts with connexin43 in C6 glioma cells: possible mechanism of connexin-mediated growth suppression.	Fu CT, etal., J Biol Chem. 2004 Aug 27;279(35):36943-50. Epub 2004 Jun 21.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Decreased expression of the angiogenic regulators CYR61 (CCN1) and NOV (CCN3) in human placenta is associated with pre-eclampsia.	Gellhaus A, etal., Mol Hum Reprod. 2006 Jun;12(6):389-99. Epub 2006 May 4.
4.	Identification of a prognostic 5-Gene expression signature for gastric cancer.	Hou JY, etal., J Cancer Res Clin Oncol. 2017 Apr;143(4):619-629. doi: 10.1007/s00432-016-2324-z. Epub 2016 Dec 29.
5.	Novel effects of CCN3 that may direct the differentiation of chondrocytes.	Janune D, etal., FEBS Lett. 2011 Oct 3;585(19):3033-40. doi: 10.1016/j.febslet.2011.08.024. Epub 2011 Aug 23.
6.	Cooperative regulation of chondrocyte differentiation by CCN2 and CCN3 shown by a comprehensive analysis of the CCN family proteins in cartilage.	Kawaki H, etal., J Bone Miner Res. 2008 Nov;23(11):1751-64. doi: 10.1359/jbmr.080615.
7.	NOV/CCN3 attenuates inflammatory pain through regulation of matrix metalloproteinases-2 and -9.	Kular L, etal., J Neuroinflammation. 2012 Feb 21;9:36. doi: 10.1186/1742-2094-9-36.
8.	NOV/CCN3 promotes maturation of cerebellar granule neuron precursors.	Le Dreau G, etal., Mol Cell Neurosci. 2009 Mar 12.
9.	Nephroblastoma overexpressed gene (NOV) codes for a growth factor that induces protein tyrosine phosphorylation.	Liu C, etal., Gene 1999 Oct 1;238(2):471-8.
10.	Determination of a potential role of the CCN family of growth regulators in connexin43 transfected C6 glioma cells.	McLeod TL, etal., Cell Commun Adhes 2001;8(4-6):441-5.
11.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.	GOA pipeline	RGD automated data pipeline
13.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:12050162	PMID:12695522	PMID:15181016	PMID:15345329	PMID:15489334	PMID:15611078	PMID:17463287	PMID:20139355	PMID:20635690	PMID:21063504	PMID:21209863	PMID:22538190
PMID:23653360	PMID:23705021	PMID:24006456	PMID:24406215	PMID:24722330	PMID:27853940	PMID:30149912	PMID:31494663

Genomics

Comparative Map Data

Ccn3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	87,983,788 - 87,990,810 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	87,982,216 - 87,994,581 (+)	Ensembl				GRCr8
mRatBN7.2	7	86,094,000 - 86,101,022 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	86,094,000 - 86,101,019 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	87,980,947 - 87,987,976 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	90,182,154 - 90,189,181 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	89,987,634 - 89,994,661 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	94,375,134 - 94,382,154 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	94,375,020 - 94,383,024 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	95,015,159 - 95,022,179 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	91,162,676 - 91,169,696 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	82,897,053 - 82,904,052 (+)	NCBI		Celera
RGSC_v3.1	7	91,196,905 - 91,203,925 (+)	NCBI
Cytogenetic Map	7	q32	NCBI

CCN3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	119,416,446 - 119,424,434 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	119,416,446 - 119,424,434 (+)	Ensembl			hg38	GRCh38
GRCh37	8	120,428,686 - 120,436,674 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	120,497,882 - 120,505,776 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	8	120,497,881 - 120,505,776	NCBI
Celera	8	116,617,968 - 116,626,094 (+)	NCBI		Celera
Cytogenetic Map	8	q24.12	NCBI
HuRef	8	115,749,069 - 115,757,195 (+)	NCBI		HuRef
CHM1_1	8	120,469,559 - 120,477,685 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	8	120,544,918 - 120,552,906 (+)	NCBI		T2T-CHM13v2.0

Ccn3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	54,609,306 - 54,617,158 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	54,609,098 - 54,617,435 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	15	54,745,910 - 54,753,762 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	54,745,702 - 54,754,039 (+)	Ensembl			mm10	GRCm38
MGSCv37	15	54,577,483 - 54,585,317 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	15	54,576,011 - 54,583,845 (+)	NCBI		MGSCv36	mm8
Celera	15	56,280,961 - 56,288,712 (+)	NCBI		Celera
Cytogenetic Map	15	D1	NCBI
cM Map	15	21.49	NCBI

Ccn3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955417	25,218,613 - 25,225,755 (+)	NCBI	ChiLan1.0	ChiLan1.0

CCN3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	136,840,741 - 136,849,075 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	112,353,155 - 112,361,507 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	116,105,935 - 116,114,241 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	118,856,969 - 118,865,039 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	118,855,445 - 118,865,039 (+)	Ensembl			panPan2	panpan1.1

CCN3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	13	18,507,586 - 18,515,755 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	13	18,507,580 - 18,514,619 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	13	18,513,047 - 18,521,248 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	13	18,834,948 - 18,843,041 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	13	18,834,910 - 18,843,404 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	13	18,562,694 - 18,570,869 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	13	18,661,289 - 18,669,494 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	13	18,892,544 - 18,900,635 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ccn3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	19,752,276 - 19,759,704 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936470	27,178,621 - 27,185,564 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936470	27,178,439 - 27,185,554 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CCN3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	19,505,701 - 19,514,406 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	19,505,698 - 19,514,481 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	20,525,288 - 20,534,032 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CCN3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	113,989,862 - 113,998,187 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	113,990,152 - 113,998,261 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666039	26,294,069 - 26,302,119 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ccn3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624763	17,573,718 - 17,580,925 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624763	17,573,693 - 17,580,884 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ccn3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	229,161,004 - 229,169,029 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ccn3
42 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	222
Count of miRNA genes:	155
Interacting mature miRNAs:	176
Transcripts:	ENSRNOT00000011904
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10053722	Scort27	Serum corticosterone level QTL 27	2.41	0.0083	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	45113903	90113903	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	82111245	123048330	Rat
2317035	Aia16	Adjuvant induced arthritis QTL 16	2.71		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	7	71103011	106126789	Rat
1357336	Gluco6	Glucose level QTL 6	3.4		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	7	51700643	96700643	Rat
1358361	Sradr5	Stress Responsive Adrenal Weight QTL 5	5.55		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	7	31770293	110435881	Rat
70159	Bp61	Blood pressure QTL 61		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	73618702	118618702	Rat
1298525	Cm1	Cardiac mass QTL 1	2.7		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	7	56625161	101625161	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	71621154	114982716	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	46307490	127866166	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	85043242	130043242	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	85497398	130497398	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	83626689	128626689	Rat
631529	Tls2	T-lymphoma susceptibility QTL 2	0	0.001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	7	82111382	132099989	Rat
1559283	Emca4	Estrogen-induced mammary cancer QTL 4	3.7		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	7	63889858	108889858	Rat
1300151	Bp181	Blood pressure QTL 181	3.36		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	7	55498584	105834451	Rat
738030	Anxrr8	Anxiety related response QTL 8	4.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	48475049	93475049	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	10112916	99900612	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	1	104117804	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
631201	Panci1	Pancreas inflammation QTL 1	0	0.001	pancreas integrity trait (VT:0010560)	percentage of study population displaying chronic pancreatitis at a point in time (CMO:0001214)	7	73557047	118557047	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	1509236	116977875	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	82111245	123048330	Rat
1641908	Teswt1	Testicular weight QTL 1	3.28		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	7	82111245	96700643	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	40540077	123682549	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	49682832	115766396	Rat
10450862	Kidm55	Kidney mass QTL 55	4.9		kidney mass (VT:0002707)	kidney weight (CMO:0000081)	7	72725037	117725037	Rat
724537	Niddm52	Non-insulin dependent diabetes mellitus QTL 52		0.02	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	82111245	95485241	Rat
1298528	Bp169	Blood pressure QTL 169		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	62963207	107963207	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	82111245	134948181	Rat
1576303	Ept7	Estrogen-induced pituitary tumorigenesis QTL 7	3.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	7	63889858	108889858	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
10450856	Livw4	Liver weight QTL 4	3.8		liver mass (VT:0003402)	liver weight (CMO:0000092)	7	72725037	117725037	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	49682832	115766396	Rat
10402855	Bp379	Blood pressure QTL 379		0.21	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	78682549	123682549	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	49682832	115766396	Rat
2303582	Gluco53	Glucose level QTL 53	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	7	48603087	93603087	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	71621154	119349044	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	71827901	136544683	Rat

Markers in Region

RH139893

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	7	87,990,483 - 87,990,685 (+)	Marker Load Pipeline
mRatBN7.2	7	86,100,695 - 86,100,897 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	94,381,828 - 94,382,029	NCBI	Rnor6.0
Rnor_5.0	7	95,021,853 - 95,022,054	UniSTS	Rnor5.0
RGSC_v3.4	7	91,169,370 - 91,169,571	UniSTS	RGSC3.4
Celera	7	82,903,726 - 82,903,927	UniSTS
Cytogenetic Map	7	q31	UniSTS

Nov

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	86,094,278 - 86,094,400 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	94,375,413 - 94,375,534	NCBI	Rnor6.0
Rnor_5.0	7	95,015,438 - 95,015,559	UniSTS	Rnor5.0
RGSC_v3.4	7	91,162,955 - 91,163,076	UniSTS	RGSC3.4
Celera	7	82,897,311 - 82,897,432	UniSTS
Cytogenetic Map	7	q31	UniSTS

Nov

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	86,094,436 - 86,095,889 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	94,375,571 - 94,377,021	NCBI	Rnor6.0
Rnor_5.0	7	95,015,596 - 95,017,046	UniSTS	Rnor5.0
RGSC_v3.4	7	91,163,113 - 91,164,563	UniSTS	RGSC3.4
Celera	7	82,897,469 - 82,898,919	UniSTS
Cytogenetic Map	7	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	158	91	90	59	78	59	6	338	178	11	137	77	92	31	14	14

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_030868	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF171936	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC072548	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000011904 ⟹ ENSRNOP00000011904

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	86,094,000 - 86,101,019 (+)	Ensembl
Rnor_6.0 Ensembl	7	94,375,020 - 94,383,024 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000165993 ⟹ ENSRNOP00000106990

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	87,982,216 - 87,994,581 (+)	Ensembl

RefSeq Acc Id:

NM_030868 ⟹ NP_110495

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	87,983,788 - 87,990,810 (+)	NCBI
mRatBN7.2	7	86,094,000 - 86,101,022 (+)	NCBI
Rnor_6.0	7	94,375,134 - 94,382,154 (+)	NCBI
Rnor_5.0	7	95,015,159 - 95,022,179 (+)	NCBI
RGSC_v3.4	7	91,162,676 - 91,169,696 (+)	RGD
Celera	7	82,897,053 - 82,904,052 (+)	RGD

Sequence:

show sequence

GTCCCGTCTCCAACTGGTAACAGCCCCAGCAGGCAGAACATGAGCGTCTTCCTGCGAAAGCAAT
GCCTCTGCCTAGGCTTCCTGCTCCTCCATCTCTTAAATCAAGTCTCTGCAACTCTGCGCTGCCC
GTCTCGGTGCCCGAGCCAGTGCCCCAGTATATCACCGACCTGCGCCCCCGGGGTGCGCTCGGTG
CTAGACGGCTGCTCCTGCTGTCCGGTGTGCGCCCGCCAGCGCGGGGAGAGTTGCTCTGAGATGA
GACCCTGCGACCAGAGCAGCGGTCTCTACTGCGACCGCAGCGCGGACCCCAACAACGAGACTGG
CATTTGCATGGTTCCAGAGGGAGACAACTGTGTGTTCGATGGGGTCATTTACCGCAATGGAGAG
AAGTTTGAGCCGAACTGTCAATACCACTGCACCTGCAGAGATGGGCAAATTGGCTGTGTGCCCC
GCTGCCAGCTGGATGTGCTTCTGCCAGGTCCTGACTGCCCAGCTCCAAAAAAAGTCGCAGTGCC
CGGGGAGTGTTGCGAAAAGTGGACCTGTGGCTCAGAGGAGAAGGGGACACTGGGAGGCCTGGCC
CTTCCAGCCTACAGACCGGAAGCTACCGTAGGAGTCGAACTCTCTGACTCCAGCATCAACTGCA
TTGAGCAGACTACAGAGTGGAGCGCGTGTTCCAAGAGCTGTGGAATGGGCTTGTCCACCCGGGT
CACCAACAGGAATCTCCAATGTGAGATGGTAAAACAGACTCGTCTCTGCATGGTTCGGCCTTGT
GAGCAAGAGCCTGGGGAAGCAACAGACATGAAAGGTAAAAAGTGTCTCCGGACCAAGAAGTCCC
TGAAATCCATCCACCTACAGTTCAAGAATTGCACTAGCCTGTACACCTATAAGCCCAGGTTCTG
TGGGATCTGCAGTGACGGGCGCTGCTGTACGCCCTTCAATACCAAAACCATCCAGGTGGAGTTT
CAGTGTTTGCCAGGGCAAATCATCAAAAAACCAGTCATGGTCATTGGAACCTGTACCTGCCACT
CCAACTGCCCTCAGAACAATGAGGCCTTCCTCCAAGAGCTGGAGCTGAAGACGAGCAGAGGAGA
AATGTAACAGGTGCCCAGGGAAGTGCATTCGTTGAGGCAAACTGTTGCTGTCACAAGGCCCGCC
ATCACCTGTATATAAGAAACATAGTGAAGGAGTTGTCCCGTGTATGTTTCTGTGATCATATGAG
GTCATTTATATTTGTCTCTGTTTTTAATGAAAACTGTTCCAAATGTAAACTTAGAATCAAGATA
AGCTCAGGATATGGCTTAGGGGTGACTTGCTTTCCTGTGCTGTTCATTACAAGTGCAAATTTGT
GTAAATTTAAGTCACATAGATGATCTAGTTGGTAGAATGTGTCACATCACACTCATTTTCTGTA
CATTAGTTAAATCCCAATAAATGTTACAGAAATGATTGGCACAAAAAAAAAAAAAAAAAAAAAA
AAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_110495	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD49371	(Get FASTA)	NCBI Sequence Viewer
	AAH72548	(Get FASTA)	NCBI Sequence Viewer
	EDM16261	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000011904.3
GenBank Protein	Q9QZQ5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_110495 ⟸ NM_030868
- Peptide Label:	precursor
- UniProtKB:	Q9QZQ5 (UniProtKB/Swiss-Prot), A6HRG0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSVFLRKQCLCLGFLLLHLLNQVSATLRCPSRCPSQCPSISPTCAPGVRSVLDGCSCCPVCARQ RGESCSEMRPCDQSSGLYCDRSADPNNETGICMVPEGDNCVFDGVIYRNGEKFEPNCQYHCTCR DGQIGCVPRCQLDVLLPGPDCPAPKKVAVPGECCEKWTCGSEEKGTLGGLALPAYRPEATVGVE LSDSSINCIEQTTEWSACSKSCGMGLSTRVTNRNLQCEMVKQTRLCMVRPCEQEPGEATDMKGK KCLRTKKSLKSIHLQFKNCTSLYTYKPRFCGICSDGRCCTPFNTKTIQVEFQCLPGQIIKKPVM VIGTCTCHSNCPQNNEAFLQELELKTSRGEM hide sequence

Ensembl Acc Id:

ENSRNOP00000011904 ⟸ ENSRNOT00000011904

Ensembl Acc Id:

ENSRNOP00000106990 ⟸ ENSRNOT00000165993

Protein Domains

CTCK IGFBP N-terminal TSP type-1 VWFC

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9QZQ5-F1-model_v2	AlphaFold	Q9QZQ5	1-351	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695330

Promoter ID:

EPDNEW_R5855

Type:

multiple initiation site

Name:

Nov_1

Description:

nephroblastoma overexpressed

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	94,375,111 - 94,375,171	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621553	AgrOrtholog
BioCyc Gene	G2FUF-33391	BioCyc
Ensembl Genes	ENSRNOG00000008697	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00000085949	Ensembl
Ensembl Transcript	ENSRNOT00000011904.6	UniProtKB/Swiss-Prot
Gene3D-CATH	2.20.100.10	UniProtKB/Swiss-Prot
	Complement Module, domain 1	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7105981	IMAGE-MGC_LOAD
InterPro	CCN	UniProtKB/Swiss-Prot
	Cys_knot_C	UniProtKB/Swiss-Prot
	Glyco_hormone_CN	UniProtKB/Swiss-Prot
	Growth_fac_rcpt_cys_sf	UniProtKB/Swiss-Prot
	IGFBP-like	UniProtKB/Swiss-Prot
	IGFBP_CNN	UniProtKB/Swiss-Prot
	Insulin_GF-bd_Cys-rich_CS	UniProtKB/Swiss-Prot
	TSP1_CCN	UniProtKB/Swiss-Prot
	TSP1_rpt	UniProtKB/Swiss-Prot
	TSP1_rpt_sf	UniProtKB/Swiss-Prot
	VWF_dom	UniProtKB/Swiss-Prot
KEGG Report	rno:81526	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:91659	IMAGE-MGC_LOAD
NCBI Gene	81526	ENTREZGENE
PANTHER	CCN FAMILY MEMBER 3	UniProtKB/Swiss-Prot
	CONNECTIVE TISSUE GROWTH FACTOR-RELATED	UniProtKB/Swiss-Prot
Pfam	Cys_knot	UniProtKB/Swiss-Prot
	IGFBP	UniProtKB/Swiss-Prot
	TSP1_CCN	UniProtKB/Swiss-Prot
	VWC	UniProtKB/Swiss-Prot
PhenoGen	Ccn3	PhenoGen
PIRSF	IGFBP_rP_CNN	UniProtKB/Swiss-Prot
PROSITE	CTCK_1	UniProtKB/Swiss-Prot
	CTCK_2	UniProtKB/Swiss-Prot
	IGFBP_N_1	UniProtKB/Swiss-Prot
	IGFBP_N_2	UniProtKB/Swiss-Prot
	TSP1	UniProtKB/Swiss-Prot
	VWFC_1	UniProtKB/Swiss-Prot
	VWFC_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000008697	RatGTEx
	ENSRNOG00000085949	RatGTEx
SMART	SM00041	UniProtKB/Swiss-Prot
	SM00121	UniProtKB/Swiss-Prot
	TSP1	UniProtKB/Swiss-Prot
	VWC	UniProtKB/Swiss-Prot
Superfamily-SCOP	FnI-like domain	UniProtKB/Swiss-Prot
	SSF57184	UniProtKB/Swiss-Prot
	SSF82895	UniProtKB/Swiss-Prot
UniProt	A0ABK0LY96_RAT	UniProtKB/TrEMBL
	A6HRG0	ENTREZGENE, UniProtKB/TrEMBL
	CCN3_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-11-02	Ccn3	cellular communication network factor 3	Nov	nephroblastoma overexpressed	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-10-05	Nov	nephroblastoma overexpressed	Nov	nephroblastoma overexpressed gene	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Nov	nephroblastoma overexpressed gene		NOV protein	Name updated	1299863	APPROVED
2002-08-07	Nov	NOV protein			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	colocalizes with Cx43 plaques at the cell membrane	633367

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar