Advanced Search (OLGA)

Gene: Gng11 (G protein subunit gamma 11) Rattus norvegicus

Analyze

Symbol:

Gng11

Name:

G protein subunit gamma 11

RGD ID:

621515

Description:

Predicted to enable G-protein beta-subunit binding activity. Predicted to be involved in G protein-coupled receptor signaling pathway. Predicted to be located in plasma membrane. Predicted to be part of heterotrimeric G-protein complex. Orthologous to human GNG11 (G protein subunit gamma 11); PARTICIPATES IN chemokine mediated signaling pathway; glutamate signaling pathway; INTERACTS WITH 1,2,4-trimethylbenzene; 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

guanine nucleotide binding protein (G protein), gamma 11; guanine nucleotide binding protein gamma subunit 11; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11-like; LOC100912034

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	32,977,681 - 32,983,121 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	32,977,664 - 32,984,438 (+)	Ensembl				GRCr8
mRatBN7.2	4	32,023,003 - 32,028,443 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	32,023,003 - 32,028,442 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	36,995,710 - 37,001,147 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	32,921,836 - 32,927,273 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	31,286,319 - 31,291,754 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	28,989,170 - 28,994,610 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	31,387,420 - 31,392,856 (+)	Ensembl			rn6	Rnor6.0
Rnor_6.0 Ensembl	4	28,989,115 - 28,993,621 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	28,897,478 - 28,902,918 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	28,847,907 - 28,853,347 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	27,409,779 - 27,415,196 (+)	NCBI		Celera
Cytogenetic Map	4	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

juvenile rheumatoid arthritis (ISO)

lung adenocarcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (ISO)

1,2,4-trimethylbenzene (EXP)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dichlorophenol (ISO)

2,6-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

2-methylcholine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsenite(3-) (ISO)

belinostat (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bleomycin A5 (ISO)

cadmium dichloride (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper(II) chloride (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

dexamethasone (ISO)

dioxygen (ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

ethanol (ISO)

flutamide (EXP)

furan (EXP)

genistein (ISO)

indoles (EXP)

indometacin (ISO)

irinotecan (ISO)

ketoconazole (ISO)

lead diacetate (ISO)

melittin (ISO)

mercury dibromide (ISO)

methotrexate (ISO)

methylmercury chloride (ISO)

methylparaben (ISO)

morphine (ISO)

nickel sulfate (ISO)

nicotine (ISO)

nitrates (ISO)

oxaliplatin (EXP)

panobinostat (ISO)

paracetamol (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

piroxicam (ISO)

progesterone (ISO)

rac-lactic acid (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

temozolomide (ISO)

tetrachloromethane (ISO)

titanium dioxide (ISO)

topotecan (EXP)

tributylstannane (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

triphenyl phosphate (ISO)

undecane (EXP)

valproic acid (ISO)

vinclozolin (EXP)

vorinostat (ISO)

zinc sulfate (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

G protein-coupled receptor signaling pathway (IBA,IEA)

signal transduction (IEA)

Cellular Component

heterotrimeric G-protein complex (IBA,IEA)

plasma membrane (IEA)

Molecular Function

G-protein beta-subunit binding (IBA,IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

chemokine mediated signaling pathway (IEA)

glutamate signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	Isolation of cDNA clones encoding eight different human G protein gamma subunits, including three novel forms designated the gamma 4, gamma 10, and gamma 11 subunits.	Ray K, etal., J Biol Chem 1995 Sep 15;270(37):21765-71.
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:12477932

Genomics

Comparative Map Data

Gng11
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	32,977,681 - 32,983,121 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	32,977,664 - 32,984,438 (+)	Ensembl				GRCr8
mRatBN7.2	4	32,023,003 - 32,028,443 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	32,023,003 - 32,028,442 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	36,995,710 - 37,001,147 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	32,921,836 - 32,927,273 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	31,286,319 - 31,291,754 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	28,989,170 - 28,994,610 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	31,387,420 - 31,392,856 (+)	Ensembl			rn6	Rnor6.0
Rnor_6.0 Ensembl	4	28,989,115 - 28,993,621 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	28,897,478 - 28,902,918 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	28,847,907 - 28,853,347 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	27,409,779 - 27,415,196 (+)	NCBI		Celera
Cytogenetic Map	4	q13	NCBI

GNG11
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	93,921,735 - 93,928,610 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	93,921,735 - 93,928,610 (+)	Ensembl			hg38	GRCh38
GRCh37	7	93,551,047 - 93,557,922 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	93,388,952 - 93,393,762 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	7	93,195,749 - 93,200,475	NCBI
Celera	7	88,249,318 - 88,254,128 (+)	NCBI		Celera
Cytogenetic Map	7	q21.3	NCBI
HuRef	7	88,158,590 - 88,163,399 (+)	NCBI		HuRef
CHM1_1	7	93,481,248 - 93,486,058 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	95,157,662 - 95,164,537 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	92,880,183 - 92,884,993 (+)	NCBI

Gng11
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	4,003,987 - 4,008,445 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	4,003,904 - 4,008,445 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	4,003,987 - 4,008,445 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	4,003,904 - 4,008,445 (+)	Ensembl			mm10	GRCm38
MGSCv37	6	3,953,987 - 3,958,445 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	3,953,987 - 3,958,445 (+)	NCBI		MGSCv36	mm8
Celera	6	4,150,596 - 4,155,058 (+)	NCBI		Celera
Cytogenetic Map	6	A1	NCBI
cM Map	6	1.81	NCBI

Gng11
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955432	10,664,170 - 10,668,953 (+)	Ensembl
ChiLan1.0	NW_004955432	10,664,251 - 10,668,749 (+)	NCBI	ChiLan1.0	ChiLan1.0

GNG11
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	111,757,939 - 111,763,065 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	160,022,679 - 160,027,706 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	85,870,321 - 85,875,309 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	99,461,797 - 99,466,632 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	99,461,797 - 99,466,632 (+)	Ensembl			panPan2	panpan1.1

GNG11
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	19,426,916 - 19,431,232 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	14	19,426,685 - 19,431,235 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	18,986,494 - 18,990,804 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	19,241,337 - 19,245,636 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	19,240,179 - 19,245,639 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	19,394,040 - 19,398,345 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	19,129,161 - 19,133,467 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	19,386,428 - 19,390,738 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gng11
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	32,737,913 - 32,742,239 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936803	57,151 - 62,047 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936803	57,659 - 62,005 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GNG11
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	73,721,322 - 73,726,222 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	9	73,721,327 - 73,726,229 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	80,762,603 - 80,767,399 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GNG11
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	55,098,259 - 55,103,077 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	55,098,261 - 55,102,722 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666042	49,221,631 - 49,227,303 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gng11
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624813	599,979 - 603,619 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624813	599,485 - 603,921 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Gng11
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	6	134,604,664 - 134,609,063 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Gng11
35 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	365
Count of miRNA genes:	146
Interacting mature miRNAs:	176
Transcripts:	ENSRNOT00000074048, ENSRNOT00000075326
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2302371	Stl22	Serum triglyceride level QTL 22	5.15		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	13080146	58080146	Rat
2303585	Bw86	Body weight QTL 86	4		body mass (VT:0001259)	body weight (CMO:0000012)	4	15644309	60644309	Rat
8552906	Pigfal3	Plasma insulin-like growth factor 1 level QTL 3			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	11038706	56038706	Rat
1357341	Gluco5	Glucose level QTL 5	6.4		adipocyte free fatty acid secretion trait (VT:0010465)	absolute change in adipocyte free fatty acid secretion per unit volume (CMO:0001446)	4	1	34142783	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	27730518	170099664	Rat
1357343	Gluco4	Glucose level QTL 4		0.00002	adipocyte glucose uptake trait (VT:0004185)	adipocyte maximal glucose uptake to basal glucose uptake ratio (CMO:0000874)	4	1	34142783	Rat
8552782	Vie1	Viral induced encephalitis QTL 1	26.4		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	1	35396961	Rat
6478766	Anxrr47	Anxiety related response QTL 47		0.09637	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	11038706	56038706	Rat
70222	Eae2	Experimental allergic encephalomyelitis QTL 2	4.3		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	4	22288453	40471598	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	26234499	134199155	Rat
631642	Stl2	Serum triglyceride level QTL 2	3.3		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5894575	57613242	Rat
6478769	Anxrr48	Anxiety related response QTL 48		0.02514	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	11038706	56038706	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	11706604	92690519	Rat
2313401	Anxrr27	Anxiety related response QTL 27			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	4	18900697	63900697	Rat
631209	Bw2	Body weight QTL2	4.2		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	1	45429897	Rat
8552803	Bw144	Body weight QTL 144	16		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	4	1	35396961	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	27862204	126119996	Rat
8694374	Bw155	Body weight QTL 155	3.39	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	4	11038706	56038706	Rat
8552801	Bw143	Body weight QTL 143	7.3		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	4	1	35396961	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5889999	148002343	Rat
61412	Pia2	Pristane induced arthritis QTL 2	3.9		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	4	22288453	63245191	Rat
8552807	Vie4	Viral induced encephalitis QTL 4	7.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	18900697	63900697	Rat
6478724	Anxrr35	Anxiety related response QTL 35		0.00449	defecation behavior trait (VT:0010462)	defecation measurement (CMO:0000997)	4	11038706	56038706	Rat
8655906	Rf60	Renal function QTL 60	3.8		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	4	30448961	82336920	Rat
61415	Eae11	Experimental allergic encephalomyelitis QTL 11	2.9		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	4	1	40471598	Rat
619616	Bp79	Blood pressure QTL 79		0.0292	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	5889999	50889999	Rat
8552809	Vie5	Viral induced encephalitis QTL 5	25.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	1	35396961	Rat
7387227	Uae40	Urinary albumin excretion QTL 40	2.9	0.0052	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	18913151	63913151	Rat
6909122	Insul22	Insulin level QTL 22	4.63		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	4	27862204	62997402	Rat
738021	Hcar13	Hepatocarcinoma resistance QTL 13	4.3		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	4	1	33538816	Rat
1358203	Stl19	Serum triglyceride level QTL 19	2.8	0.002	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	21925151	66925151	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	4	1	63900697	Rat
9590304	Scort17	Serum corticosterone level QTL 17	4.96	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	11038706	56038706	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat
1354665	Stl10	Serum triglyceride level QTL 10	3.57		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	22288453	45429897	Rat
1300141	Bp178	Blood pressure QTL 178			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	10758701	40490708	Rat

Markers in Region

RH128150

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	32,027,165 - 32,027,368 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	31,391,580 - 31,391,782	NCBI	Rnor6.0
Rnor_6.0	4	28,993,333 - 28,993,535	NCBI	Rnor6.0
Rnor_5.0	4	28,901,641 - 28,901,843	UniSTS	Rnor5.0
Rnor_5.0	4	31,295,387 - 31,295,589	UniSTS	Rnor5.0
RGSC_v3.4	4	28,852,070 - 28,852,272	UniSTS	RGSC3.4
Celera	4	27,413,919 - 27,414,121	UniSTS
Cytogenetic Map	4	q13	UniSTS

RH133225

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	32,028,131 - 32,028,350 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	31,392,546 - 31,392,764	NCBI	Rnor6.0
Rnor_6.0	4	28,994,299 - 28,994,517	NCBI	Rnor6.0
Rnor_5.0	4	31,296,353 - 31,296,571	UniSTS	Rnor5.0
Rnor_5.0	4	28,902,607 - 28,902,825	UniSTS	Rnor5.0
RGSC_v3.4	4	28,853,036 - 28,853,254	UniSTS	RGSC3.4
Celera	4	27,414,885 - 27,415,103	UniSTS
RH 3.4 Map	4	475.01	UniSTS
Cytogenetic Map	4	q13	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
19	1	30	112	68	60	36	79	36	12	254	143	11	87	56	70	24	15	15

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022396	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC094253	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF257110	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC097320	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210187	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210395	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224783	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000074048 ⟹ ENSRNOP00000065818

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	32,977,664 - 32,984,438 (+)	Ensembl
mRatBN7.2 Ensembl	4	32,023,003 - 32,028,442 (+)	Ensembl
Rnor_6.0 Ensembl	4	31,387,420 - 31,392,856 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000075326 ⟹ ENSRNOP00000066965

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	4	28,989,115 - 28,993,621 (+)	Ensembl

RefSeq Acc Id:

NM_022396 ⟹ NP_071791

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	32,977,681 - 32,983,121 (+)	NCBI
mRatBN7.2	4	32,023,003 - 32,028,443 (+)	NCBI
Rnor_6.0	4	28,989,170 - 28,994,610 (+)	NCBI
Rnor_5.0	4	28,897,478 - 28,902,918 (+)	NCBI
RGSC_v3.4	4	28,847,907 - 28,853,347 (+)	RGD
Celera	4	27,409,779 - 27,415,196 (+)	RGD

Sequence:

show sequence

GCAGCCTTCCAGGAGCAGCCAGGAAGATGTCTCAAACTTAACCCTCTGCAAGCTGCCAGGCTAA
AGGGCTGGTAGAGCCTGGAGAAGCCGCCCTGAGGTTGCTTGGAGTCTGGGAAAGGCCATCGGGA
GCAGGCTTGGGCAGGAAGCTGAGCCCCCGGGGAGCTGAGAGCTGCGGTTCGAGCCAGTCACGTC
CTGCGCACGGAGGGCGGGTAGCCTCGGCCCGCCGGTATTTGGGGAAGCGTCCCAGTTCTAGGCG
CTTCCAGTGGCTGCCTTGCACAAGTGACTTCTGGGCCCAGCTCTGGGGCAAAGATGCCCGCCCT
TCACATTGAGGATCTGCCGGAAAAGGAAAAACTGAAGATGGAGGTTGAGCAACTTCGCAAAGAA
GTGAAGTTGCAGAGACAACAGGTGTCTAAATGTTCTGAGGAAATAAAGAACTACATTGAAGAAC
GTTCTGGAGAGGATCCTCTGGTAAAGGGAATTCCAGAAGACAAGAATCCCTTCAAAGAAAAGGG
CAGCTGTGTCATTTCCTAAGGAACTCTGGAGGGAAATTGTTTTCAGTTGGGTCAGATTGTTCTT
TTGTTTAATTTTTCCCCCAAATGAAGCCAAAGTGTGTGTGAAGAATTGAGGAAAAAATGAAATC
GAGAAAAAGACTGTCATATAAGCACTCTCCAAGCACTTTGTGCATAGAACAAACCTGCTTCTCA
CCCACACACCCTCTCTCAGAGGAGAGCACCTGAGTGCAGTTATGGGATGAAGGCCTGGCTCTCC
CTTTCAATATACTGCTTGCTGTCTCCAATAAAGTTTTACCTTGAAAAAAAAATCAATGGTAGTG
ACCTAAGATAGCACCTTTTATTCATTAACTCTTGAGTTTCCTTCTATAACCTGTCCAGTGTTTG
GGGTTTATGTCATAAGATTAGGAATATAAATGACGTGGTTTGCAACACAGCTCTCCCTTACTCA
TGTGTTTACAATGCCAAAGTCTGACTTCTGGAATGTGTTAGATTTAACTATTAGAGAACCCAGC
GGGTAGGATTCCTAATGACATTAACAGGAGTCAGGTGGTGAGTCAGGAACTTTGCCAAACCAAG
TCGACATTAGCACATCCCTGGTTTGCGATGATTCAGTTCAAAATATCCCTGCAGCAGTGTCCTT
GGGAAATGGGACAAGTATGTGAATGGGAAAAAGAACCCTCATCCAAGAATGCTGGCTGCCAGGG
CTAGTTCTTTTGCTGACCCAGATCTACATTCCTTGTTCTCTCCAGGTCTGGGGATGGTTCCTCT
TTAGTTCTGTGGCCTCTGGGTAGATGTTTGAATGTCTTCCACCTCTTCCTCCTCTTCCTCCTCT
TCCTCCTCTTCCTCCTCTTCCTCCTTTTCCCTTTTCCCCTCCTTCATCTTTTATCTTCTCCAAA
AGATACAGTGAATTTTGACTAATTTAAAAAGATCAATTGGATGTTTTCCTGTCATTGTGAAAGC
TCACCATGTCTTCTTTTCCTCCTCTATTGCTGCTGTCCATTACAAGCCCCTCCTTCCAATCAAT
GGCCCCACTTTCTATGGCAAGTTGAGCTTCTGTAGTTTTAAGTACAATTCATGCTGAGGTCATT
ATGAAGGCACCTGTGACTAAGACAGCAATGAAAGAGACATTTCTTCCTCTGGAAAAAACTTTTC
TCATTTCCCCCGTCTCTTGTTTTGGGATTGTTAGAGATTTGGAATGAAAGTGAAATAAAATCTT
TACAAATAGGTTCTGGTTCAACTATGTCTAGTTACTAACATGCTCTATGGCATTAAATGTGGTA
TCCAAAGACTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_071791	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF68984	(Get FASTA)	NCBI Sequence Viewer
	AAH97320	(Get FASTA)	NCBI Sequence Viewer
	EDL84396	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000065818
	ENSRNOP00000065818.1
GenBank Protein	P61954	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_071791 ⟸ NM_022396
- UniProtKB:	Q4V8M0 (UniProtKB/Swiss-Prot), P61954 (UniProtKB/Swiss-Prot), A6K2B4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPF KEKGSCVIS hide sequence

Ensembl Acc Id:

ENSRNOP00000066965 ⟸ ENSRNOT00000075326

Ensembl Acc Id:

ENSRNOP00000065818 ⟸ ENSRNOT00000074048

Protein Domains

G protein gamma

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P61954-F1-model_v2	AlphaFold	P61954	1-73	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621515	AgrOrtholog
BioCyc Gene	G2FUF-45728	BioCyc
Ensembl Genes	ENSRNOG00000047914	Ensembl
	ENSRNOG00000050469	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000074048	ENTREZGENE
	ENSRNOT00000074048.2	UniProtKB/Swiss-Prot
Gene3D-CATH	4.10.260.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7455035	IMAGE-MGC_LOAD
InterPro	G-protein_gamma-like_dom	UniProtKB/Swiss-Prot
	GGL_sf	UniProtKB/Swiss-Prot
	Gprotein-gamma	UniProtKB/Swiss-Prot
KEGG Report	rno:64199	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:114323	IMAGE-MGC_LOAD
NCBI Gene	64199	ENTREZGENE
PANTHER	PTHR13809	UniProtKB/Swiss-Prot
Pfam	G-gamma	UniProtKB/Swiss-Prot
PhenoGen	Gng11	PhenoGen
PRINTS	GPROTEING	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_GAMMA	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000047914	RatGTEx
	ENSRNOG00000050469	RatGTEx
SMART	G_gamma	UniProtKB/Swiss-Prot
	GGL	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF48670	UniProtKB/Swiss-Prot
UniProt	A6K2B4	ENTREZGENE, UniProtKB/TrEMBL
	GBG11_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q4V8M0	ENTREZGENE
UniProt Secondary	P50152	UniProtKB/Swiss-Prot
	Q4V8M0	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Gng11	G protein subunit gamma 11	LOC100912034	guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11-like	Data merged from RGD:6489513	737654	PROVISIONAL
2016-03-15	Gng11	G protein subunit gamma 11	Gng11	guanine nucleotide binding protein (G protein), gamma 11	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-05	LOC100912034	guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2004-09-10	Gng11	guanine nucleotide binding protein (G protein), gamma 11		guanine nucleotide binding protein gamma subunit 11	Name updated	1299863	APPROVED
2002-08-07	Gng11	guanine nucleotide binding protein gamma subunit 11			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)