Advanced Search (OLGA)

Gene: Adam1a (ADAM metallopeptidase domain 1a) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Adam1a

Name:

ADAM metallopeptidase domain 1a

RGD ID:

621467

Description:

Predicted to enable metalloendopeptidase activity. Involved in male gonad development. Predicted to be located in membrane raft. Predicted to be active in external side of plasma membrane and sperm head plasma membrane. Orthologous to human ADAM1A (ADAM metallopeptidase domain 1A (pseudogene)); INTERACTS WITH (S)-amphetamine; 17beta-estradiol; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

a disintegrin and metallopeptidase domain 1a; a disintegrin and metalloprotease domain 1 (fertilin alpha); a disintegrin and metalloproteinase domain 1; a disintegrin and metalloproteinase domain 1 (fertilin alpha); ADAM 1; Adam1; disintegrin and metalloproteinase domain-containing protein 1; fertilin alpha; fertilin subunit alpha; MGC93473; PH-30 alpha; PH-30a

RGD Orthologs

Human

Mouse

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	40,674,460 - 40,680,988 (+)	NCBI		GRCr8
mRatBN7.2	12	35,017,433 - 35,020,300 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	35,017,315 - 35,020,311 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	36,190,238 - 36,193,105 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	36,801,446 - 36,804,313 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	35,853,895 - 35,856,762 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	40,533,731 - 40,536,632 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	40,533,632 - 40,536,620 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	42,399,946 - 42,403,868 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	36,151,883 - 36,155,069 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	36,015,270 - 36,018,457 (+)	NCBI
Celera	12	36,682,101 - 36,684,968 (+)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Adam1a	Rat	(S)-amphetamine	increases expression	EXP		6480464	Dextroamphetamine results in increased expression of ADAM1A mRNA	CTD	PMID:16715494
Adam1a	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Adam1a (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of ADAM1A mRNA	CTD	PMID:22206623
Adam1a	Rat	17beta-estradiol	decreases expression	EXP		6480464	Estradiol results in decreased expression of ADAM1A mRNA	CTD	PMID:35192832
Adam1a	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2 and 4-dinitrotoluene affects the expression of ADAM1A mRNA	CTD	PMID:21346803
Adam1a	Rat	3,4-methylenedioxymethamphetamine	decreases expression	ISO	Adam1a (Mus musculus)	6480464	N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of ADAM1A mRNA	CTD	PMID:20188158
Adam1a	Rat	3-chloropropane-1,2-diol	decreases expression	EXP		6480464	alpha-Chlorohydrin results in decreased expression of ADAM1A mRNA	CTD	PMID:28522335
Adam1a	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of ADAM1A mRNA	CTD	PMID:30047161
Adam1a	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of ADAM1A mRNA	CTD	PMID:31881176
Adam1a	Rat	aflatoxin B1	increases expression	ISO	Adam1a (Mus musculus)	6480464	Aflatoxin B1 results in increased expression of ADAM1A mRNA	CTD	PMID:19770486
Adam1a	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of ADAM1A mRNA	CTD	PMID:30047161
Adam1a	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of ADAM1A mRNA	CTD	PMID:16483693
Adam1a	Rat	benzo[a]pyrene	multiple interactions	ISO	Adam1a (Mus musculus)	6480464	Benzo(a)pyrene promotes the reaction [AHR protein binds to ADAM1A promoter]	CTD	PMID:19654925
Adam1a	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of ADAM1A mRNA	CTD	PMID:25181051
Adam1a	Rat	bisphenol A	decreases expression	ISO	Adam1a (Mus musculus)	6480464	bisphenol A results in decreased expression of ADAM1A mRNA	CTD	PMID:32156529 and PMID:38074096
Adam1a	Rat	bisphenol A	decreases methylation	ISO	Adam1a (Mus musculus)	6480464	bisphenol A results in decreased methylation of ADAM1A promoter	CTD	PMID:27312807
Adam1a	Rat	bisphenol F	decreases expression	ISO	Adam1a (Mus musculus)	6480464	bisphenol F results in decreased expression of ADAM1A mRNA	CTD	PMID:38685157
Adam1a	Rat	clozapine	decreases expression	EXP		6480464	Clozapine results in decreased expression of ADAM1A mRNA	CTD	PMID:16715494
Adam1a	Rat	cocaine	multiple interactions	ISO	Adam1a (Mus musculus)	6480464	HDAC5 affects the reaction [Cocaine affects the expression of ADAM1A mRNA]	CTD	PMID:17988634
Adam1a	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of ADAM1A mRNA	CTD	PMID:27523638
Adam1a	Rat	dioxygen	multiple interactions	EXP		6480464	[Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in decreased expression of ADAM1A mRNA	CTD	PMID:33729688
Adam1a	Rat	fipronil	decreases expression	ISO	ADAM1A (Homo sapiens)	6480464	fipronil results in decreased expression of ADAM1A mRNA	CTD	PMID:28991164
Adam1a	Rat	fipronil	multiple interactions	ISO	ADAM1A (Homo sapiens)	6480464	[fipronil co-treated with DEET] results in decreased expression of ADAM1A mRNA	CTD	PMID:28991164
Adam1a	Rat	flavonoids	increases expression	EXP		6480464	Flavonoids results in increased expression of ADAM1A mRNA	CTD	PMID:18035473
Adam1a	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of ADAM1A mRNA	CTD	PMID:33387578
Adam1a	Rat	haloperidol	decreases expression	EXP		6480464	Haloperidol results in decreased expression of ADAM1A mRNA	CTD	PMID:16715494
Adam1a	Rat	isoflurane	increases methylation	ISO	Adam1a (Mus musculus)	6480464	Isoflurane results in increased methylation of ADAM1A mRNA	CTD	PMID:35249202
Adam1a	Rat	lead diacetate	increases expression	EXP		6480464	lead acetate results in increased expression of ADAM1A mRNA	CTD	PMID:22641619
Adam1a	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of ADAM1A mRNA	CTD	PMID:30047161
Adam1a	Rat	methylmercury chloride	decreases expression	ISO	ADAM1A (Homo sapiens)	6480464	methylmercuric chloride results in decreased expression of ADAM1A mRNA	CTD	PMID:28001369
Adam1a	Rat	methylphenidate	increases expression	EXP		6480464	Methylphenidate results in increased expression of ADAM1 mRNA	CTD	PMID:17105903
Adam1a	Rat	N,N-diethyl-m-toluamide	multiple interactions	ISO	ADAM1A (Homo sapiens)	6480464	[fipronil co-treated with DEET] results in decreased expression of ADAM1A mRNA	CTD	PMID:28991164
Adam1a	Rat	N-ethyl-N-nitrosourea	increases mutagenesis	ISO	Adam1a (Mus musculus)	6480464	Ethylnitrosourea results in increased mutagenesis of ADAM1A mRNA	CTD	PMID:27776689
Adam1a	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of ADAM1A mRNA	CTD	PMID:33387578
Adam1a	Rat	paraquat	decreases expression	EXP		6480464	Paraquat results in decreased expression of ADAM1A mRNA	CTD	PMID:32680482
Adam1a	Rat	phenobarbital	increases expression	EXP		6480464	Phenobarbital results in increased expression of ADAM1A mRNA	CTD	PMID:12832660
Adam1a	Rat	pirinixic acid	increases expression	EXP		6480464	pirinixic acid results in increased expression of ADAM1A mRNA	CTD	PMID:19162173
Adam1a	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of ADAM1A mRNA	CTD	PMID:30047161
Adam1a	Rat	sunitinib	increases expression	ISO	ADAM1A (Homo sapiens)	6480464	Sunitinib results in increased expression of ADAM1A mRNA	CTD	PMID:31533062
Adam1a	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of ADAM1A mRNA	CTD	PMID:34492290
Adam1a	Rat	trichloroethene	decreases expression	EXP		6480464	Trichloroethylene results in decreased expression of ADAM1A mRNA	CTD	PMID:33387578
Adam1a	Rat	Triptolide	increases expression	ISO	Adam1a (Mus musculus)	6480464	triptolide results in increased expression of ADAM1A mRNA	CTD	PMID:32835833
Adam1a	Rat	trovafloxacin	increases expression	ISO	Adam1a (Mus musculus)	6480464	trovafloxacin results in increased expression of ADAM1A mRNA	CTD	PMID:35537566
Adam1a	Rat	valproic acid	increases expression	ISO	ADAM1A (Homo sapiens)	6480464	Valproic Acid results in increased expression of ADAM1 mRNA	CTD	PMID:23179753
Adam1a	Rat	valproic acid	decreases expression	ISO	ADAM1A (Homo sapiens)	6480464	Valproic Acid results in decreased expression of ADAM1A mRNA	CTD	PMID:28001369
Adam1a	Rat	vinclozolin	increases expression	EXP		6480464	vinclozolin results in increased expression of ADAM1A mRNA	CTD	PMID:23034163

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Adam1a	Rat	binding of sperm to zona pellucida	involved_in	IBA	MGI:2429504 and PANTHER:PTN002275900	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Adam1a	Rat	binding of sperm to zona pellucida	acts_upstream_of_or_within	ISO	Adam1a (Mus musculus)	1624291	MGI:3052660 PMID:15194697	RGD	PMID:15194697
Adam1a	Rat	male gonad development		IEP		10047128		RGD
Adam1a	Rat	male gonad development	involved_in	IBA	PANTHER:PTN000224928 and Adam1a (Rattus norvegicus)	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Adam1a	Rat	proteolysis	involved_in	IEA	InterPro:IPR001590	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Adam1a	Rat	proteolysis	involved_in	IEA	UniProtKB-KW:KW-0645	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Adam1a	Rat	proteolysis	involved_in	IBA	FB:FBgn0034903 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Adam1a	Rat	proteolysis	involved_in	NAS		68863	PMID:9358007	UniProt

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Adam1a	Rat	external side of plasma membrane	is_active_in	IBA	MGI:104731 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Adam1a	Rat	membrane	located_in	NAS		68863	PMID:9358007	UniProt
Adam1a	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Adam1a	Rat	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Adam1a	Rat	membrane raft	located_in	ISO	Adam1a (Mus musculus)	1624291	PMID:15194697	RGD	PMID:15194697
Adam1a	Rat	plasma membrane	is_active_in	IBA	MGI:102518 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Adam1a	Rat	sperm head plasma membrane	is_active_in	IBA	MGI:104731 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Adam1a	Rat	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Adam1a	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Adam1a	Rat	metalloendopeptidase activity	enables	IEA	InterPro:IPR001590	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Adam1a	Rat	metalloendopeptidase activity	enables	IBA	FB:FBgn0034903 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Adam1a	Rat	metallopeptidase activity	enables	NAS		68863	PMID:9358007	UniProt
Adam1a	Rat	metallopeptidase activity	enables	IEA	UniProtKB-KW:KW-0482	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Adam1a	Rat	metallopeptidase activity	enables	IEA	InterPro:IPR024079	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Adam1a	Rat	peptidase activity	enables	IEA	UniProtKB-KW:KW-0645	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Adam1a	Rat	protein binding	enables	ISO	Adam1a (Mus musculus)	1624291	PR:Q60718 PMID:15194697	RGD	PMID:15194697

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Cloning and sequence analysis of rat fertilin alpha and beta--developmental expression, processing and immunolocalization.	McLaughlin EA, etal., Mol Hum Reprod 1997 Sep;3(9):801-9.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comprehensive gene review and curation	RGD comprehensive gene curation
8.	Chronological gene expression of ADAMs during testicular development: prespermatogonia (gonocytes) express fertilin beta (ADAM2).	Rosselot C, etal., Dev Dyn. 2003 Jul;227(3):458-67.
9.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

PMID:15194697

Adam1a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	40,674,460 - 40,680,988 (+)	NCBI		GRCr8
mRatBN7.2	12	35,017,433 - 35,020,300 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	35,017,315 - 35,020,311 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	36,190,238 - 36,193,105 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	36,801,446 - 36,804,313 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	35,853,895 - 35,856,762 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	40,533,731 - 40,536,632 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	40,533,632 - 40,536,620 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	42,399,946 - 42,403,868 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	36,151,883 - 36,155,069 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	36,015,270 - 36,018,457 (+)	NCBI
Celera	12	36,682,101 - 36,684,968 (+)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

ADAM1A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	111,899,063 - 111,901,902 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	111,899,263 - 111,901,391 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	112,336,867 - 112,339,706 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	110,821,350 - 110,823,989 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	12	111,962,428 - 111,965,067 (+)	NCBI		Celera
Cytogenetic Map	12	q24.12-q24.13	NCBI
HuRef	12	109,350,284 - 109,353,123 (+)	NCBI		HuRef
CHM1_1	12	112,304,798 - 112,307,637 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	111,875,972 - 111,878,811 (+)	NCBI		T2T-CHM13v2.0

Adam1a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	121,656,667 - 121,659,758 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	121,656,639 - 121,660,134 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	121,518,604 - 121,521,695 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	121,518,576 - 121,545,482 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	121,968,613 - 121,971,704 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	119,581,839 - 119,584,930 (-)	NCBI		MGSCv36	mm8
MGSCv36	5	121,779,221 - 121,782,312 (-)	NCBI		MGSCv36	mm8
Celera	5	118,608,591 - 118,611,529 (-)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	61.84	NCBI

Variants in Adam1a
8 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	15
Count of miRNA genes:	15
Interacting mature miRNAs:	15
Transcripts:	ENSRNOT00000001818
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
8693635	Alc28	Alcohol consumption QTL 28	2.7	0.439	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	23081340	44726024	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
9590147	Scort7	Serum corticosterone level QTL 7	13.61	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	12	1	42110980	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
737822	Alc10	Alcohol consumption QTL 10	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	19610870	40218516	Rat
70169	Eae13	Experimental allergic encephalomyelitis QTL 13		0.032	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	12	24139202	36638073	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	28064433	46669029	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
1556747	Calcic1	Intracellular calcium level QTL 1		3.6	platelet calcium amount (VT:0010500)	platelet intracellular calcium level (CMO:0000922)	12	28064433	40130419	Rat
631829	Alc6	Alcohol consumption QTL 6	4.7		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	28607526	37691617	Rat
8693658	Alc33	Alcohol consumption QTL 33	2.1	0.68	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	23081340	43551788	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
8694179	Bw150	Body weight QTL 150	2.9	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411545	Bw128	Body weight QTL 128	5.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610889	35682913	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
7411660	Foco28	Food consumption QTL 28	10.9	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	19835789	38193007	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	20328819	46669029	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610870	42828880	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	32103174	45899022	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
9590086	Insglur6	Insulin/glucose ratio QTL 6	18.97	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	12	1	42110980	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	28064433	45899022	Rat
1331787	Rf41	Renal function QTL 41	2.998		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	12	28064557	40218380	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	36247923	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	13635523	35682913	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
7411586	Foco5	Food consumption QTL 5	5.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	1	42450532	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
7411595	Foco9	Food consumption QTL 9	4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	15550826	38478808	Rat

BF388151

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	35,020,069 - 35,020,250 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	40,536,402 - 40,536,582	NCBI	Rnor6.0
Rnor_5.0	12	42,403,638 - 42,403,818	UniSTS	Rnor5.0
RGSC_v3.4	12	36,154,839 - 36,155,019	UniSTS	RGSC3.4
Celera	12	36,684,738 - 36,684,918	UniSTS
RH 3.4 Map	12	613.2	UniSTS
Cytogenetic Map	12	q16	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_020078	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271602	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC081807	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Y08616	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001818

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	35,017,315 - 35,020,311 (+)	Ensembl
Rnor_6.0 Ensembl	12	40,533,632 - 40,536,620 (+)	Ensembl

RefSeq Acc Id:

NM_020078 ⟹ NP_064463

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	40,678,121 - 40,680,988 (+)	NCBI
mRatBN7.2	12	35,017,433 - 35,020,300 (+)	NCBI
Rnor_6.0	12	40,533,731 - 40,536,632 (+)	NCBI
Rnor_5.0	12	42,399,946 - 42,403,868 (+)	NCBI
RGSC_v3.4	12	36,151,883 - 36,155,069 (+)	RGD
Celera	12	36,682,101 - 36,684,968 (+)	RGD

Sequence:

show sequence

GGGCTCGTCTCCATGAGCGTCAAAGGAACTTAAGCCACACTGGAGCTCTTCCACTTGACAAAAGTCCCTGTGCTGCACATAACCAACGAGGCCAGGAGAAAAATAAGACCAGAGATACCGCCTGAGGC
CAGAGGATTCACGCAGGGGAGCACCCCTTAAGGGACAGGCTTGGGTCTGGGAAAGCAGTGAGTTGCCACTGATGGACATAGATCCTACGCTATCCACAGTTTGTTTGAACCATGTCAGTGGCAGCATC
AGCGAGCAGGAGTGCGTCCACGCTGTGTTCTCCACAGATCCAGCAAGGAGCCTTAAAAGAAGCTAAGGTGCCCCCTCACATCTGGGCTGCACGGCATTGGAACCTGGGTCTACGACTAGTGCCAGGAC
ACGCATCTGTTAGAGCAGGGATCTTGGTGCTACTGATTTTTCTCCCGAGCACGCTCTGTGACCTAGGATCTGTATATGACTCTTCCTATGAGACGGTCATCCCCGAGAGACTGCCAGGCCAGGGGAGT
GACGATCCTGGAGGGAAGGTGTCCTACGTGCTGTTGATGCAAGGCCAAAAGCAGCTGCTTCACCTCGAGGTAAAGGGACACTACTCTGAGAGGAACTTCCCGGTCTACAGCTACCACCATGGTATCCT
GGGGCAAGAAGTGCCCCTCCTCTCCCAGGCCTGCCACTATGAAGGCCACATAGAAGGGGTGCCAGGCTCCTTTGTTTCTGTCAGCATCTGTTCAGGCCTCAGGGGGGTCTTGATCAAAGAGGAAACAG
CCTATGGCATCGAGCCCCTGCTCTTTTCCACAGACTTTGAGCACATCCTCTATACCATGGCGCACCAGCCTGTGGTCCTCTGCAATGTCACTCCTACAGACAGCCTGGGGGACTCCAGCCAGCGACAA
GGGAGCAGCAAGACCGATGAGCTGCTGGCTCTGTCTGACTTGTGGTCACACGCCAAGTATGTGGAGATGTTTGTCGTGGTCAACCACCAGCGCTTCCAGATGTGGGGCAGTGATGTCAACACGACGGT
CCAGGCGGTAGTGGACATCATTGCTCTGGCCAACAGCTTCACTAGGGGAATAAACACAGAGGTGGTGCTGGTGGGCCTGGAGATCTGGACAGAGGGGGACCCGATAGAGGTCCCAGTGGACCTGCAGG
CTACACTGAGGAATTTCAACTTGTGGAGACAGGAGAAACTCATGGGCCGGGTCAGGCACGATGTGGCACACTTGATCGTCGGGCATCGCCCAGGAGCGAACGAGGGCCAGGCGTTTCTCGATGGTGCC
TGTTCAGGCGGGTTTGCGGCGGCCGTGGAGGCCTTCCATCATGAGGATGTCCTCCTGTTTGCGGCGCTCATGGCCCACGAGCTTGGGCACAACCTGGGTATCCGGCACGACCGTCCAGGCTGCACCTG
TGGTCCTAAGCACCTCTGCCTCATGCATGAGACGATCAGTAAGACCAGTGGCTTCAGCAACTGCAGCTCTGACCACTTCCTCCGTTTCCTCCATGACCACAGAGGGGCCTGCCTGCTTGACCGGCCTT
GGCACCAGAGCCACAAGCGCAGAGATGCCCATTGTGGAAACGGTGTGGTAGAGGAGTCGGAGGAGTGTGACTGTGGTAATGCCTGTGACAGTCACCCATGCTGTGAGCCAACATGTACACTGAAGGTG
GGTGCGCAGTGCAGTGAGGGACTCTGCTGCTACAAATGTACATTCAAGAAGAAAGGGACCTTATGTCGTCCTGCTGAGGATGTATGTGACCTTCCCGAGTACTGCAATGGCATTACTGGAGAATGCCC
TGCAAACAGCTACATGCAGGACGGCACGCAGTGCGATAGGATTTATTACTGCTCTGGGGGTTTGTGTAAGAACCCTGATAAGCAATGTGCAAGGATCTATGGGTATCCTGCAAGATCGGCCCCCGAGG
AGTGTTACATTTCAGTTAATACTAAAGCCAACCGGTTTGGAAATTGTGGCCATCCCACCTCGGCTAACCTAAAATATGAAGCATGTTCCAATGAGGATATATTTTGTGGGAAGTTGGTATGCACGGAT
GTTAGATACTTGCCCCAAGTCAAGCCCCTACACTCACTCCTCCAGATTCCTTACGGAGATGACTGGTGTTGGAGCATGGATGCCTATAACGTCACTGACATCCCTGATTACGGTGACGTGCAGGGCGG
TACCTACTGTGCCCCAAAAAAAGTCTGCATGGAGTCCATCTGCACCGGTCATGCCACGCTCCAGTATGACTGTCATCCACAGGAAATGTGTCATGGGAATGGAGTGTGCAACAACTTCAAACACTGTC
ACTGTGATGCTGGCTTCTCCCCTCCTGACTGCAGCAGTGGAGGAAATGGGGGGAGTGTGGACAGTGGTCCTGTCGGGAAGCCAGCTGACCGAAACTTGAGTCTTTTTGGAGTTGGGGAGAGTCCGGAT
TCGAGGATGGAGGATGAGGAGATCAACCTCAAAGTGGTGGTGCTTGTGGTCCCCATCTTCCTTATTGTCCTGCTGTGCTGTCTAATGCTCATCGCCTACCTCTGGTCTGAAGTACAAGAGGCAGTGTC
TCCAGGGTCTTCAAGCACAACCTCGTCCTCAGAGTCCGAGTCCGACTGACGTCCGCAGACCTCCTCGTGGGCTGTTGCTACCGAGGCCGTGTGTTTGCGGGGCAGTTTTTCCTCCGTGGTTTTTAGGG
CTTGTTGCATGCACACTGTTTACTGTAATGTGTTGTATATACACTTGTGTTGCTCTTCTCTACCGTAACAACTGGTATTATCGTGTGAAAGTTTTTATGGGATCTAAATGTTCTAACTTGCCCTGTCA
GCTACTGTTCATAAAATACAAGTCATTTTAAATAAACATGAATAACAAGGCCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063271602 ⟹ XP_063127672

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	40,674,460 - 40,680,986 (+)	NCBI


Protein RefSeqs	NP_064463	(Get FASTA)	NCBI Sequence Viewer
	XP_063127672	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH81807	(Get FASTA)	NCBI Sequence Viewer
	CAA69908	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000081520
GenBank Protein	P70505	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_064463 ⟸ NM_020078

- Peptide Label:

precursor

- Sequence:

show sequence

MSVAASASRSASTLCSPQIQQGALKEAKVPPHIWAARHWNLGLRLVPGHASVRAGILVLLIFLPSTLCDLGSVYDSSYETVIPERLPGQGSDDPGGKVSYVLLMQGQKQLLHLEVKGHYSERNFPVYS
YHHGILGQEVPLLSQACHYEGHIEGVPGSFVSVSICSGLRGVLIKEETAYGIEPLLFSTDFEHILYTMAHQPVVLCNVTPTDSLGDSSQRQGSSKTDELLALSDLWSHAKYVEMFVVVNHQRFQMWGS
DVNTTVQAVVDIIALANSFTRGINTEVVLVGLEIWTEGDPIEVPVDLQATLRNFNLWRQEKLMGRVRHDVAHLIVGHRPGANEGQAFLDGACSGGFAAAVEAFHHEDVLLFAALMAHELGHNLGIRHD
RPGCTCGPKHLCLMHETISKTSGFSNCSSDHFLRFLHDHRGACLLDRPWHQSHKRRDAHCGNGVVEESEECDCGNACDSHPCCEPTCTLKVGAQCSEGLCCYKCTFKKKGTLCRPAEDVCDLPEYCNG
ITGECPANSYMQDGTQCDRIYYCSGGLCKNPDKQCARIYGYPARSAPEECYISVNTKANRFGNCGHPTSANLKYEACSNEDIFCGKLVCTDVRYLPQVKPLHSLLQIPYGDDWCWSMDAYNVTDIPDY
GDVQGGTYCAPKKVCMESICTGHATLQYDCHPQEMCHGNGVCNNFKHCHCDAGFSPPDCSSGGNGGSVDSGPVGKPADRNLSLFGVGESPDSRMEDEEINLKVVVLVVPIFLIVLLCCLMLIAYLWSE
VQEAVSPGSSSTTSSSESESD

hide sequence

RefSeq Acc Id:	XP_063127672 ⟸ XM_063271602
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5ZSY2 (UniProtKB/TrEMBL), Q66HK9 (UniProtKB/TrEMBL)

Protein Domains

Disintegrin EGF-like Peptidase M12B

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P70505-F1-model_v2	AlphaFold	P70505	1-789	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-19214	BioCyc
Ensembl Genes	ENSRNOG00000001347	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000001818	ENTREZGENE
Gene3D-CATH	3.40.390.10	UniProtKB/Swiss-Prot
	4.10.70.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7132493	IMAGE-MGC_LOAD
InterPro	ADAM_Cys-rich	UniProtKB/Swiss-Prot
	Blood-coag_inhib_Disintegrin	UniProtKB/Swiss-Prot
	Disintegrin_CS	UniProtKB/Swiss-Prot
	Disintegrin_dom_sf	UniProtKB/Swiss-Prot
	EGF_3	UniProtKB/Swiss-Prot
	MetalloPept_cat_dom	UniProtKB/Swiss-Prot
	Peptidase_M12B	UniProtKB/Swiss-Prot
	Reprolysin_adamalysin	UniProtKB/Swiss-Prot
KEGG Report	rno:56777	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93473	IMAGE-MGC_LOAD
NCBI Gene	56777	ENTREZGENE
PANTHER	ADAM A DISINTEGRIN AND METALLOPROTEASE DOMAIN	UniProtKB/Swiss-Prot
	DISINTEGRIN AND METALLOPROTEINASE DOMAIN-CONTAINING PROTEIN 1A-RELATED	UniProtKB/Swiss-Prot
Pfam	ADAM_CR	UniProtKB/Swiss-Prot
	Disintegrin	UniProtKB/Swiss-Prot
	Reprolysin	UniProtKB/Swiss-Prot
PhenoGen	Adam1a	PhenoGen
PRINTS	DISINTEGRIN	UniProtKB/Swiss-Prot
PROSITE	ADAM_MEPRO	UniProtKB/Swiss-Prot
	DISINTEGRIN_1	UniProtKB/Swiss-Prot
	DISINTEGRIN_2	UniProtKB/Swiss-Prot
	EGF_2	UniProtKB/Swiss-Prot
	EGF_3	UniProtKB/Swiss-Prot
	ZINC_PROTEASE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000001347	RatGTEx
SMART	ACR	UniProtKB/Swiss-Prot
	DISIN	UniProtKB/Swiss-Prot
Superfamily-SCOP	Disintegrin	UniProtKB/Swiss-Prot
	Metalloproteases ('zincins'), catalytic domain	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZSY2	ENTREZGENE, UniProtKB/TrEMBL
	ADAM1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q66HK9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-07-22	Adam1a	ADAM metallopeptidase domain 1a	Adam1a	ADAM metallopeptidase domain 1A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-07-13	Adam1a	ADAM metallopeptidase domain 1A	Adam1a	a disintegrin and metallopeptidase domain 1a	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Adam1a	a disintegrin and metallopeptidase domain 1a	Adam1	a disintegrin and metalloproteinase domain 1 (fertilin alpha)	Symbol and Name updated	1299863	APPROVED
2002-08-07	Adam1	a disintegrin and metalloproteinase domain 1 (fertilin alpha)			Symbol and Name status set to provisional	70820	PROVISIONAL

Note Type	Note	Reference
gene_expression	expressed in testis during all developmental stages tested	68863

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message