Artn (artemin) - Rat Genome Database

Name: Artn
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Artn (artemin) Rattus norvegicus

Analyze

Symbol:

Artn

Name:

artemin

RGD ID:

621427

Description:

Predicted to enable growth factor activity. Involved in peripheral nervous system development. Predicted to be active in extracellular space. Used to study peripheral nervous system disease. Biomarker of peripheral nervous system disease. Orthologous to human ARTN (artemin); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ARTN (artemin)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Artn (artemin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Artn (artemin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ARTN (artemin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ARTN (artemin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Artn (artemin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ARTN (artemin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ARTN (artemin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Artn (artemin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SIGLEC7 (sialic acid binding Ig like lectin 7)	HGNC	OMA
Homo sapiens (human):	SIGLEC12 (sialic acid binding Ig like lectin 12)	HGNC	OMA
Homo sapiens (human):	SIGLEC8 (sialic acid binding Ig like lectin 8)	HGNC	OMA
Homo sapiens (human):	SIGLEC9 (sialic acid binding Ig like lectin 9)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Artn (artemin)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ARTN (artemin)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pspn	Alliance	DIOPT (OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	136,750,188 - 136,755,645 (-)	NCBI		GRCr8
mRatBN7.2	5	131,458,596 - 131,470,193 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	131,464,756 - 131,468,025 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	134,169,882 - 134,173,127 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	135,924,501 - 135,927,746 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	135,946,923 - 135,950,168 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	136,759,717 - 136,765,036 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	136,759,717 - 136,762,986 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	140,548,766 - 140,554,035 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	138,390,981 - 138,394,250 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	138,396,703 - 138,397,079 (-)	NCBI
Celera	5	130,012,959 - 130,016,228 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acoustic neuroma (ISO)

Animal Disease Models (ISO)

atopic dermatitis (ISO)

Breast Neoplasms (ISO)

Charcot-Marie-Tooth disease dominant intermediate C (ISO)

developmental and epileptic encephalopathy (ISO)

early infantile epileptic encephalopathy (ISO)

pancreatic cancer (ISO)

peripheral nervous system disease (IEP,IMP)

Pruritus (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

7,12-dimethyltetraphene (ISO)

acrylamide (EXP)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

Benzo[ghi]perylene (ISO)

bisphenol A (EXP)

butan-1-ol (ISO)

camptothecin (ISO)

carbon nanotube (ISO)

carmustine (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

dexamethasone (ISO)

dioxygen (ISO)

enniatin (ISO)

ethanol (ISO)

fulvestrant (ISO)

gentamycin (EXP)

isotretinoin (ISO)

lead(0) (ISO)

mono(2-ethylhexyl) phthalate (ISO)

paracetamol (EXP)

paraquat (EXP)

resveratrol (ISO)

silicon dioxide (ISO)

tamoxifen (ISO)

temozolomide (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

triclosan (ISO)

valproic acid (EXP)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

axon guidance (ISO)

glial cell-derived neurotrophic factor receptor signaling pathway (ISO)

induction of positive chemotaxis (ISO)

lymphocyte migration into lymphoid organs (ISO)

peripheral nervous system development (IBA,IEP,ISO)

Peyer's patch morphogenesis (ISO)

Cellular Component

extracellular space (IBA,ISO)

Molecular Function

glial cell-derived neurotrophic factor receptor binding (IEA)

growth factor activity (IBA,ISO,ISS)

protein binding (ISO)

receptor tyrosine kinase binding (IEA)

signaling receptor binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Nerve growth factor and artemin are paracrine mediators of pancreatic neuropathy in pancreatic adenocarcinoma.	Ceyhan GO, etal., Ann Surg. 2010 May;251(5):923-31.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	BDNF mRNA expression is significantly upregulated in vestibular schwannomas and correlates with proliferative activity.	Kramer F, etal., J Neurooncol. 2010 May;98(1):31-9. doi: 10.1007/s11060-009-0063-6. Epub 2009 Nov 25.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Comprehensive gene review and curation	RGD comprehensive gene curation
9.	Expression of the GDNF family members and their receptors in the mature rat cochlea.	Stover T, etal., Brain Res Mol Brain Res 2000 Mar 10;76(1):25-35.
10.	Acetyl-l-carnitine increases artemin level and prevents neurotrophic factor alterations during neuropathy.	Vivoli E, etal., Neuroscience. 2010 Jun 2;167(4):1168-74. Epub 2010 Mar 16.
11.	Persistent restoration of sensory function by immediate or delayed systemic artemin after dorsal root injury.	Wang R, etal., Nat Neurosci. 2008 Apr;11(4):488-96. Epub 2008 Mar 23.
12.	Nan fang yi ke da xue xue bao = Journal of Southern Medical University	Zhu DL, etal., Nan Fang Yi Ke Da Xue Xue Bao. 2009 Mar;29(3):428-32.

Additional References at PubMed

PMID:9883723	PMID:12160745	PMID:12477932	PMID:15204970	PMID:15489334	PMID:16325003	PMID:16781061	PMID:17322904	PMID:17337595	PMID:19845789	PMID:24886596	PMID:25889103
PMID:25918373	PMID:28899786	PMID:29712778

Genomics

Comparative Map Data

Artn
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	136,750,188 - 136,755,645 (-)	NCBI		GRCr8
mRatBN7.2	5	131,458,596 - 131,470,193 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	131,464,756 - 131,468,025 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	134,169,882 - 134,173,127 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	135,924,501 - 135,927,746 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	135,946,923 - 135,950,168 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	136,759,717 - 136,765,036 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	136,759,717 - 136,762,986 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	140,548,766 - 140,554,035 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	138,390,981 - 138,394,250 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	138,396,703 - 138,397,079 (-)	NCBI
Celera	5	130,012,959 - 130,016,228 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

ARTN
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	43,933,801 - 43,937,240 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	43,933,320 - 43,937,240 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	44,399,473 - 44,402,912 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	44,171,579 - 44,175,471 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	44,070,746 - 44,071,977	NCBI
Celera	1	42,682,525 - 42,686,445 (+)	NCBI		Celera
Cytogenetic Map	1	p34.1	NCBI
HuRef	1	42,517,866 - 42,521,786 (+)	NCBI		HuRef
CHM1_1	1	44,515,224 - 44,519,144 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	43,802,329 - 43,808,317 (+)	NCBI		T2T-CHM13v2.0

Artn
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	117,783,105 - 117,787,993 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	117,783,359 - 117,786,960 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	117,925,908 - 117,930,795 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	117,926,162 - 117,929,763 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	117,598,767 - 117,602,368 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	117,424,094 - 117,427,695 (-)	NCBI		MGSCv36	mm8
Celera	4	116,641,832 - 116,645,434 (-)	NCBI		Celera
Cytogenetic Map	4	D1	NCBI
cM Map	4	53.83	NCBI

Artn
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955537	3,460,176 - 3,464,335 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955537	3,460,176 - 3,464,335 (+)	NCBI	ChiLan1.0	ChiLan1.0

ARTN
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	182,872,431 - 182,878,378 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	182,013,760 - 182,019,707 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	43,233,097 - 43,239,044 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	44,604,514 - 44,610,643 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

ARTN
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Dog10K_Boxer_Tasha	15	16,435,953 - 16,442,427 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	16,469,613 - 16,476,086 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	15	16,268,455 - 16,274,928 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	16,340,604 - 16,343,946 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	16,410,202 - 16,416,677 (-)	NCBI		UU_Cfam_GSD_1.0

Artn
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	59,423,684 - 59,434,755 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	25,252,684 - 25,253,810 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	25,252,510 - 25,254,221 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ARTN
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	167,357,662 - 167,360,729 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	167,356,363 - 167,361,370 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	154,725,018 - 154,726,492 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ARTN
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	88,869,463 - 88,874,036 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	88,869,941 - 88,871,049 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	28,051,970 - 28,057,269 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Artn
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624892	3,214,012 - 3,218,699 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624892	3,213,203 - 3,218,699 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Artn
52 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	44
Count of miRNA genes:	40
Interacting mature miRNAs:	40
Transcripts:	ENSRNOT00000026852
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
1300122	Wbc1	White blood cell count QTL 1	2.75		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	5	125392826	139989768	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	94858972	143070159	Rat
70156	Niddm30	Non-insulin dependent diabetes mellitus QTL 30	3.98		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	5	129132447	151006154	Rat
7411582	Foco3	Food consumption QTL 3	7.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	87468046	132468046	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	106906205	151906205	Rat
2317753	Glom24	Glomerulus QTL 24	3.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	5	97570330	136479578	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
7411564	Bw135	Body weight QTL 135		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	87468046	132468046	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	105999803	150999803	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	120740824	151018848	Rat
1578673	Bmd13	Bone mineral density QTL 13	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	5	103689353	148689353	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	106906205	151906205	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	106906205	151906205	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	97059760	147465714	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
7365049	Bp359	Blood pressure QTL 359			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128071929	134724733	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
1331803	Rf32	Renal function QTL 32	2.798		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	129132428	143070159	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	106906205	151906205	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	106906205	151906205	Rat
1581505	Rf54	Renal function QTL 54			kidney physiology trait (VT:0002136)	kidney 20-HETE level (CMO:0001854)	5	128033842	133011550	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	120740824	143608494	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
7411601	Foco12	Food consumption QTL 12	19.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	87468046	132468046	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
7394710	Emca12	Estrogen-induced mammary cancer QTL 12			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	124160767	133749643	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
631527	Tls1	T-lymphoma susceptibility QTL 1	0	0.001	thymus integrity trait (VT:0010555)	post-insult time to onset of T-cell lymphoma (CMO:0001907)	5	90450144	135450144	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat
6903316	Bw113	Body weight QTL 113	2	0.0103	body mass (VT:0001259)	body weight (CMO:0000012)	5	87765973	132765973	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	99216724	148607142	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	7	48	113	83	82	51	24	51	6	203	92	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053397	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006238685	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006238687	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006238691	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017593494	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110297	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110299	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF184919	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AH012647	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC079078	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000026852 ⟹ ENSRNOP00000026852

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	131,464,756 - 131,468,025 (-)	Ensembl
Rnor_6.0 Ensembl	5	136,759,717 - 136,762,986 (-)	Ensembl

RefSeq Acc Id:

NM_053397 ⟹ NP_445849

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	136,750,188 - 136,753,457 (-)	NCBI
mRatBN7.2	5	131,464,756 - 131,468,025 (-)	NCBI
Rnor_6.0	5	136,759,717 - 136,762,986 (-)	NCBI
Rnor_5.0	5	140,548,766 - 140,554,035 (-)	NCBI
RGSC_v3.4	5	138,390,981 - 138,394,250 (-)	RGD
Celera	5	130,012,959 - 130,016,228 (-)	RGD

Sequence:

show sequence

CAGCCCTCGCTACGACTGGGGCTTGGAGCCCTGCACCCGAGGGCACAGACCGGCTGCCAAGGCC
CCACTTTTAACTAAAAGAGGCGCTGCCAGGTGCACAATTCTGGGCATGATCCATTTGAGCTTCG
GGGGAAAGCCCAGCACTGGTCCCAGGGAAGGTGCCTAGAAGGACACGGAGCGGACCCCTTTGCT
GCCTCAAGAAGAGGGTGGGGAAACAGATCCACGAAGGCTGATGGGAGCTCCTGGAGTTGAAAGC
GATGGAACTGGGACTTGGAGAGCCTACTGCATTGTCCCACTGCCTCCGGCCTAGGTGGCAACCA
GCCTTGTGGCCAACCCTAGCTGCTCTAGCCCTGCTGAGCAGCGTCACAGAAGCTTCCCTGGACC
CAATGTCCCGCAGCCCCGCCTCTCGCGATGTTCCCTCGCCGGTCCTGGCGCCCCCAACAGACTA
CCTACCTGGGGGACACACCGCACATCTGTGCAGCGAAAGAGCCCTGCGACCACCGCCGCAGTCT
CCTCAGCCCGCACCCCCACCACCCGGTCCCGCGCTCCAGTCTCCTCCCGCTGCGCTCCGCGGGG
CACGCGCGGCGCGTGCAGGAACCCGGAGCAGCCGCGCACGGGCTACAGATGCGCGCGGCTGCCG
CCTGCGCTCACAGCTGGTGCCGGTGAGCGCTCTCGGCCTGGGCCACAGCTCCGACGAGCTGATA
CGTTTCCGCTTCTGCAGCGGTTCGTGCCGCCGAGCACGCTCCCCGCACGATCTCAGCCTGGCCA
GCCTGCTGGACGCCGGGGCCCTGCGGTCGCCTCCCGGGTCCCGGCCGATCAGCCAGCCCTGTTG
CCGGCCCACTCGCTATGAGGCCGTCTCCTTCATGGACGTGAACAGCACCTGGAGAACCGTGGAC
CATCTCTCCGCCACCGCCTGCGGCTGTCTGGGCTGAGGATGATCTTCAAGCTTTTGCACACTGG
ACCCATATGTCGCCCTACCTGGAACAGCCCCACGGGGCCTCACTAGCTAGGAGCCTCAACTCAA
CAGGAAGTGGAAGCTGCAGAGCTCAGGCCTCAGGCCGATGAGGGACAGACAGAGCCTGGAAAGA
TGACCGAACCACTGACCAACAGTCCCAAGGTGTTCATGGATCCCAGCTCTACAGACAGCAGAAA
CCTCAGCTAAAGAGAACTCCTCTGGGTGAATCCAGAAATGGCCCTAGGACCTCGGGAGTGCATT
TTGAGGAGATATATTGTAGTCGCGTTGCTGGACCAGCCTGTGCTGAAACCAGCCTTGTGTTCAC
TTGTGGAAGCCGAAGCCCTATTTATTATTTCTAAATTATTTATTTACTTTGAAAAAAAAAAAAA
AAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039110297 ⟹ XP_038966225

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	136,750,188 - 136,755,645 (-)	NCBI
mRatBN7.2	5	131,458,596 - 131,470,193 (-)	NCBI

RefSeq Acc Id:

XM_039110299 ⟹ XP_038966227

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	136,750,188 - 136,755,645 (-)	NCBI
mRatBN7.2	5	131,458,596 - 131,470,193 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_445849	(Get FASTA)	NCBI Sequence Viewer
	XP_038966225	(Get FASTA)	NCBI Sequence Viewer
	XP_038966227	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF01241	(Get FASTA)	NCBI Sequence Viewer
	AAH79078	(Get FASTA)	NCBI Sequence Viewer
	AAO73543	(Get FASTA)	NCBI Sequence Viewer
	AAO73544	(Get FASTA)	NCBI Sequence Viewer
	EDL90191	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000026852.2
GenBank Protein	Q6AYE8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_445849 ⟸ NM_053397
- Peptide Label:	precursor
- UniProtKB:	Q9QZG3 (UniProtKB/Swiss-Prot), Q810F7 (UniProtKB/Swiss-Prot), Q810F6 (UniProtKB/Swiss-Prot), Q6AYE8 (UniProtKB/Swiss-Prot), A6JZG2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MELGLGEPTALSHCLRPRWQPALWPTLAALALLSSVTEASLDPMSRSPASRDVPSPVLAPPTDY LPGGHTAHLCSERALRPPPQSPQPAPPPPGPALQSPPAALRGARAARAGTRSSRARATDARGCR LRSQLVPVSALGLGHSSDELIRFRFCSGSCRRARSPHDLSLASLLDAGALRSPPGSRPISQPCC RPTRYEAVSFMDVNSTWRTVDHLSATACGCLG hide sequence

Ensembl Acc Id:

ENSRNOP00000026852 ⟸ ENSRNOT00000026852

RefSeq Acc Id:	XP_038966227 ⟸ XM_039110299
- Peptide Label:	isoform X1
- UniProtKB:	Q9QZG3 (UniProtKB/Swiss-Prot), Q810F7 (UniProtKB/Swiss-Prot), Q810F6 (UniProtKB/Swiss-Prot), Q6AYE8 (UniProtKB/Swiss-Prot), A6JZG2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038966225 ⟸ XM_039110297
- Peptide Label:	isoform X1
- UniProtKB:	Q9QZG3 (UniProtKB/Swiss-Prot), Q810F7 (UniProtKB/Swiss-Prot), Q810F6 (UniProtKB/Swiss-Prot), Q6AYE8 (UniProtKB/Swiss-Prot), A6JZG2 (UniProtKB/TrEMBL)

Protein Domains

TGF-beta family profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AYE8-F1-model_v2	AlphaFold	Q6AYE8	1-224	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693961

Promoter ID:

EPDNEW_R4485

Type:

multiple initiation site

Name:

Artn_1

Description:

artemin

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	136,763,030 - 136,763,090	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621427	AgrOrtholog
BioCyc Gene	G2FUF-40175	BioCyc
Ensembl Genes	ENSRNOG00000019842	Ensembl, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000026852.4	UniProtKB/Swiss-Prot
Gene3D-CATH	2.10.90.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7122331	IMAGE-MGC_LOAD
InterPro	Cystine-knot_cytokine	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GDNF_fam	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TGF-b_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:362572	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:94034	IMAGE-MGC_LOAD
NCBI Gene	Artn	ENTREZGENE
PANTHER	ARTEMIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GDNF SUBFAMILY OF TGF-BETA FAMILY	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
Pfam	TGF_beta	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Artn	PhenoGen
PROSITE	TGF_BETA_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000019842	RatGTEx
Superfamily-SCOP	Cystine-knot cytokines	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
UniProt	A6JZG2	ENTREZGENE, UniProtKB/TrEMBL
	ARTN_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q810F6	ENTREZGENE
	Q810F7	ENTREZGENE
	Q9QZG3	ENTREZGENE
UniProt Secondary	Q810F6	UniProtKB/Swiss-Prot
	Q810F7	UniProtKB/Swiss-Prot
	Q9QZG3	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-01-20	Artn	artemin			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Artn	artemin			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in cochlea and substantia nigra	631959
gene_product	member of the glial cell line-derived neurotrophic factor subgroup of the TGF-beta growth factor superfamily	631959

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD