Symbol:
Srp54a
Name:
signal recognition particle 54A
RGD ID:
621390
Description:
Predicted to enable several functions, including 7S RNA binding activity; endoplasmic reticulum signal peptide binding activity; and guanyl ribonucleotide binding activity. Predicted to contribute to GTPase activity. Predicted to be involved in several processes, including SRP-dependent cotranslational protein targeting to membrane; exocrine pancreas development; and neutrophil chemotaxis. Predicted to be located in cytoplasm and nucleus. Predicted to be part of signal recognition particle, endoplasmic reticulum targeting. Predicted to be active in cytosol. Human ortholog(s) of this gene implicated in severe congenital neutropenia 8. Orthologous to human SRP54 (signal recognition particle 54); INTERACTS WITH 2,6-dinitrotoluene; 6-propyl-2-thiouracil; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
signal recognition particle 54; signal recognition particle 54 kDa; signal recognition particle 54kDa; signal recognition particle subunit SRP54; Srp54
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 78,322,308 - 78,362,017 (+) NCBI GRCr8 mRatBN7.2 6 72,587,584 - 72,626,878 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 72,587,605 - 72,625,189 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 73,010,076 - 73,047,802 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 73,316,425 - 73,354,151 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 72,745,035 - 72,782,580 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 75,996,629 - 76,035,768 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 75,996,643 - 76,034,083 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 85,532,350 - 85,572,100 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 75,446,838 - 75,494,001 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 75,474,626 - 75,478,796 (+) NCBI Celera 6 71,428,873 - 71,466,500 (+) NCBI Celera Cytogenetic Map 6 q23 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Srp54a Rat 1,2-dichloroethane increases expression ISO Srp54a (Mus musculus) 6480464 ethylene dichloride results in increased expression of SRP54A mRNA CTD PMID:28960355 Srp54a Rat 1,2-dimethylhydrazine multiple interactions ISO Srp54a (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SRP54A mRNA CTD PMID:22206623 Srp54a Rat 17alpha-ethynylestradiol increases expression ISO Srp54a (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of SRP54 mRNA CTD PMID:17942748 Srp54a Rat 17alpha-ethynylestradiol multiple interactions ISO Srp54a (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SRP54 mRNA CTD PMID:17942748 Srp54a Rat 17beta-estradiol increases expression ISO Srp54a (Mus musculus) 6480464 Estradiol results in increased expression of SRP54A mRNA CTD PMID:39298647 Srp54a Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Srp54a (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SRP54 mRNA CTD PMID:17942748 Srp54a Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO SRP54 (Homo sapiens) 6480464 [Tetrachlorodibenzodioxin co-treated with 2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide] results in decreased expression of SRP54 mRNA CTD PMID:29704546 Srp54a Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Srp54a (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SRP54 mRNA CTD PMID:21570461 Srp54a Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Srp54a (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of SRP54 mRNA CTD PMID:19933214 Srp54a Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of SRP54 mRNA CTD PMID:21346803 Srp54a Rat 4,4'-sulfonyldiphenol increases expression ISO Srp54a (Mus musculus) 6480464 bisphenol S results in increased expression of SRP54A mRNA CTD PMID:39298647 Srp54a Rat 4,4'-sulfonyldiphenol increases expression ISO SRP54 (Homo sapiens) 6480464 bisphenol S results in increased expression of SRP54 protein CTD PMID:34186270 Srp54a Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of SRP54A mRNA CTD PMID:30047161 Srp54a Rat aflatoxin B1 decreases methylation ISO SRP54 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of SRP54 gene CTD PMID:27153756 Srp54a Rat all-trans-retinoic acid increases expression ISO SRP54 (Homo sapiens) 6480464 Tretinoin results in increased expression of SRP54 mRNA CTD PMID:33167477 Srp54a Rat aristolochic acid A decreases expression ISO SRP54 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of SRP54 mRNA CTD PMID:33212167 Srp54a Rat Aroclor 1254 decreases expression ISO Srp54a (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of SRP54 mRNA CTD PMID:23650126 Srp54a Rat benzene increases expression ISO SRP54 (Homo sapiens) 6480464 Benzene results in increased expression of SRP54 mRNA CTD PMID:19162166 Srp54a Rat benzo[a]pyrene affects expression ISO Srp54a (Mus musculus) 6480464 Benzo(a)pyrene affects the expression of SRP54 mRNA CTD PMID:22342234 Srp54a Rat beta-lapachone increases expression ISO SRP54 (Homo sapiens) 6480464 beta-lapachone results in increased expression of SRP54 mRNA CTD PMID:38218311 Srp54a Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of SRP54 mRNA CTD PMID:25181051 Srp54a Rat bisphenol A decreases expression ISO Srp54a (Mus musculus) 6480464 bisphenol A results in decreased expression of SRP54A mRNA CTD PMID:33221593 Srp54a Rat bisphenol A affects expression ISO SRP54 (Homo sapiens) 6480464 bisphenol A affects the expression of SRP54 mRNA CTD PMID:30903817 Srp54a Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of SRP54 gene CTD PMID:28505145 Srp54a Rat bisphenol AF increases expression ISO SRP54 (Homo sapiens) 6480464 bisphenol AF results in increased expression of SRP54 protein CTD PMID:34186270 Srp54a Rat bisphenol F increases expression ISO Srp54a (Mus musculus) 6480464 bisphenol F results in increased expression of SRP54A mRNA CTD PMID:38685157 Srp54a Rat cadmium atom multiple interactions ISO SRP54 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of SRP54 mRNA CTD PMID:35301059 Srp54a Rat cadmium dichloride multiple interactions ISO SRP54 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of SRP54 mRNA CTD PMID:35301059 Srp54a Rat cyclosporin A increases expression ISO SRP54 (Homo sapiens) 6480464 Cyclosporine results in increased expression of SRP54 mRNA CTD PMID:20106945 Srp54a Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of SRP54A mRNA CTD PMID:23914054 Srp54a Rat dicrotophos decreases expression ISO SRP54 (Homo sapiens) 6480464 dicrotophos results in decreased expression of SRP54 mRNA CTD PMID:28302478 Srp54a Rat dioxygen increases expression ISO Srp54a (Mus musculus) 6480464 Oxygen deficiency results in increased expression of SRP54A mRNA CTD PMID:24205000 Srp54a Rat dioxygen affects methylation ISO Srp54a (Mus musculus) 6480464 Oxygen deficiency affects the methylation of SRP54A promoter CTD PMID:24205000 Srp54a Rat doxorubicin increases expression ISO SRP54 (Homo sapiens) 6480464 Doxorubicin results in increased expression of SRP54 mRNA CTD PMID:29803840 Srp54a Rat epoxiconazole increases expression ISO Srp54a (Mus musculus) 6480464 epoxiconazole results in increased expression of SRP54A mRNA CTD PMID:35436446 Srp54a Rat ethanol multiple interactions ISO SRP54 (Homo sapiens) 6480464 [[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of SRP54 mRNA CTD PMID:29432896 Srp54a Rat folic acid decreases expression ISO Srp54a (Mus musculus) 6480464 Folic Acid results in decreased expression of SRP54A mRNA CTD PMID:25629700 Srp54a Rat folic acid multiple interactions ISO Srp54a (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SRP54A mRNA CTD PMID:22206623 Srp54a Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of SRP54A mRNA CTD PMID:33387578 Srp54a Rat isobutanol multiple interactions ISO SRP54 (Homo sapiens) 6480464 [[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of SRP54 mRNA CTD PMID:29432896 Srp54a Rat ivermectin decreases expression ISO SRP54 (Homo sapiens) 6480464 Ivermectin results in decreased expression of SRP54 protein CTD PMID:32959892 Srp54a Rat ketoconazole increases expression ISO SRP54 (Homo sapiens) 6480464 Ketoconazole results in increased expression of SRP54 mRNA CTD PMID:36621641 Srp54a Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of SRP54A mRNA CTD PMID:30467583 Srp54a Rat methidathion decreases expression ISO Srp54a (Mus musculus) 6480464 methidathion results in decreased expression of SRP54A mRNA CTD PMID:34813904 Srp54a Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of SRP54A mRNA CTD PMID:30047161 Srp54a Rat ozone multiple interactions ISO SRP54 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of SRP54 mRNA CTD PMID:35430440 Srp54a Rat paracetamol affects expression ISO Srp54a (Mus musculus) 6480464 Acetaminophen affects the expression of SRP54A mRNA CTD PMID:17562736 Srp54a Rat propiconazole increases expression ISO Srp54a (Mus musculus) 6480464 propiconazole results in increased expression of SRP54 mRNA CTD PMID:21278054 Srp54a Rat resveratrol decreases expression EXP 6480464 resveratrol results in decreased expression of SRP54A mRNA CTD PMID:25905778 Srp54a Rat resveratrol multiple interactions ISO SRP54 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of SRP54 mRNA CTD PMID:23557933 Srp54a Rat Salinomycin decreases expression ISO SRP54 (Homo sapiens) 6480464 salinomycin results in decreased expression of SRP54 mRNA CTD PMID:19682730 Srp54a Rat sodium arsenite increases expression ISO SRP54 (Homo sapiens) 6480464 sodium arsenite results in increased expression of SRP54 mRNA CTD PMID:38568856 Srp54a Rat sodium arsenite multiple interactions ISO SRP54 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of and results in increased activity of SRP54 protein CTD PMID:30528433 Srp54a Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of SRP54A mRNA CTD PMID:30047161 Srp54a Rat taurine decreases expression ISO SRP54 (Homo sapiens) 6480464 Taurine results in decreased expression of SRP54 mRNA CTD PMID:16579726 Srp54a Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of SRP54A mRNA CTD PMID:31150632 Srp54a Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of SRP54A protein CTD PMID:35544339 Srp54a Rat titanium dioxide increases methylation ISO Srp54a (Mus musculus) 6480464 titanium dioxide results in increased methylation of SRP54A promoter CTD PMID:35295148 Srp54a Rat trichostatin A affects expression ISO SRP54 (Homo sapiens) 6480464 trichostatin A affects the expression of SRP54 mRNA CTD PMID:28542535 Srp54a Rat triphenyl phosphate affects expression ISO SRP54 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SRP54 mRNA CTD PMID:37042841 Srp54a Rat tunicamycin increases expression ISO SRP54 (Homo sapiens) 6480464 Tunicamycin results in increased expression of SRP54 mRNA CTD PMID:22378314 Srp54a Rat valproic acid affects expression ISO Srp54a (Mus musculus) 6480464 Valproic Acid affects the expression of SRP54 mRNA CTD PMID:17292431 Srp54a Rat valproic acid increases expression ISO SRP54 (Homo sapiens) 6480464 Valproic Acid results in increased expression of SRP54 mRNA CTD PMID:29154799 Srp54a Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of SRP54A mRNA CTD PMID:23034163 Srp54a Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of SRP54A gene CTD PMID:31682807
Srp54a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 78,322,308 - 78,362,017 (+) NCBI GRCr8 mRatBN7.2 6 72,587,584 - 72,626,878 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 72,587,605 - 72,625,189 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 73,010,076 - 73,047,802 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 73,316,425 - 73,354,151 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 72,745,035 - 72,782,580 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 75,996,629 - 76,035,768 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 75,996,643 - 76,034,083 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 85,532,350 - 85,572,100 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 75,446,838 - 75,494,001 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 75,474,626 - 75,478,796 (+) NCBI Celera 6 71,428,873 - 71,466,500 (+) NCBI Celera Cytogenetic Map 6 q23 NCBI
SRP54 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 34,982,992 - 35,029,567 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 34,981,957 - 35,029,686 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 35,452,198 - 35,498,773 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 34,521,982 - 34,568,519 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 34,521,981 - 34,568,517 NCBI Celera 14 15,315,912 - 15,362,600 (+) NCBI Celera Cytogenetic Map 14 q13.2 NCBI HuRef 14 15,564,659 - 15,611,702 (+) NCBI HuRef CHM1_1 14 35,450,690 - 35,497,725 (+) NCBI CHM1_1 T2T-CHM13v2.0 14 29,181,721 - 29,228,319 (+) NCBI T2T-CHM13v2.0
Srp54a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 55,127,318 - 55,162,152 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 55,127,047 - 55,162,152 (+) Ensembl GRCm39 Ensembl GRCm38 12 55,080,476 - 55,115,367 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 55,080,262 - 55,115,367 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 56,181,483 - 56,216,354 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 55,998,696 - 56,031,814 (+) NCBI MGSCv36 mm8 Celera 12 56,371,141 - 56,408,843 (+) NCBI Celera Cytogenetic Map 12 C1 NCBI cM Map 12 23.86 NCBI
Srp54 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955409 25,977,226 - 26,016,351 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955409 25,977,226 - 26,016,351 (-) NCBI ChiLan1.0 ChiLan1.0
LOC100987236 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 36,293,771 - 36,393,170 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 35,510,292 - 35,609,673 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 15,733,446 - 15,779,987 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 33,920,330 - 33,966,023 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 33,920,287 - 34,017,151 (+) Ensembl panpan1.1 panPan2
SRP54 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 13,800,275 - 13,837,799 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 13,677,760 - 13,837,722 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 13,597,521 - 13,634,635 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 13,907,202 - 13,944,631 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 13,907,474 - 13,944,627 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 13,608,264 - 13,646,077 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 13,673,490 - 13,710,632 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 13,962,922 - 13,999,855 (+) NCBI UU_Cfam_GSD_1.0
LOC101965130 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 45,677,956 - 45,741,100 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936494 9,183,632 - 9,222,855 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 Ensembl NW_004936494 9,227,321 - 9,246,955 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936494 9,183,620 - 9,220,510 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SRP54 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 64,829,228 - 64,877,195 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 64,829,625 - 64,877,574 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 69,658,033 - 69,706,782 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SRP54 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 11,802,671 - 11,846,534 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 11,812,672 - 11,846,675 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 764,178 - 808,147 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Srp54
.
Predicted Target Of
Count of predictions: 786 Count of miRNA genes: 310 Interacting mature miRNAs: 397 Transcripts: ENSRNOT00000052076 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
9590290 Uminl2 Urine mineral level QTL 2 3.96 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 6 38783989 83783989 Rat 1331799 Bp211 Blood pressure QTL 211 3.66407 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 72202632 130919985 Rat 634307 Bp141 Blood pressure QTL 141 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 35230417 80230417 Rat 634330 Pia16 Pristane induced arthritis QTL 16 3.9 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 6 45790088 104200226 Rat 1331789 Rf37 Renal function QTL 37 3.224 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 6 72202632 115200186 Rat 4145119 Mcs25 Mammary carcinoma susceptibility QTL 25 0.0001 mammary gland integrity trait (VT:0010552) ratio of deaths to total study population during a period of time (CMO:0001023) 6 10894415 110548006 Rat 70176 Mcsm1 Mammary carcinoma susceptibility modifier QTL 1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 58632962 103632962 Rat 1581563 Uae33 Urinary albumin excretion QTL 33 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 72227641 130729205 Rat 1558641 Cm47 Cardiac mass QTL 47 2.9 0.001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 6 57730540 104085867 Rat 1641904 Alcrsp4 Alcohol response QTL 4 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 6 67262953 112262953 Rat 2293839 Kiddil2 Kidney dilation QTL 2 4.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 20866422 81133036 Rat 1576309 Emca7 Estrogen-induced mammary cancer QTL 7 4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 15107216 107351382 Rat 9590140 Scort4 Serum corticosterone level QTL 4 14.49 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 38783989 83783989 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 2301964 Bp323 Blood pressure QTL 323 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 72227641 81132889 Rat 9590306 Scort18 Serum corticosterone level QTL 18 2.88 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 38783989 83783989 Rat 1578665 Bss16 Bone structure and strength QTL 16 4.4 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 6 11735669 72593685 Rat 2293841 Kiddil4 Kidney dilation QTL 4 4.4 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 20866422 81133036 Rat 4889848 Pur25 Proteinuria QTL 25 14 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 56728562 90198260 Rat 724536 Uae7 Urinary albumin excretion QTL 7 3.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 72202632 130729475 Rat 1578668 Bmd14 Bone mineral density QTL 14 3.8 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 6 11735669 72593685 Rat 6893340 Cm77 Cardiac mass QTL 77 0.26 0.57 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 6 33309549 81132889 Rat 70196 BpQTLcluster7 Blood pressure QTL cluster 7 6.82 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 72202632 117202632 Rat 1581550 Pur8 Proteinuria QTL 8 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 72227641 130729205 Rat 1300075 Glom7 Glomerulus QTL 7 5.6 0.0000002 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 6 71201409 116201409 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 1300143 Rf14 Renal function QTL 14 2.92 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 6 34434137 77102317 Rat 12801471 Schws9 Schwannoma susceptibility QTL 9 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 61747639 106747639 Rat 6893332 Cm74 Cardiac mass QTL 74 0.4 0.64 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 6 57730540 104085867 Rat
D6Rat22
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 6 78,328,752 - 78,328,841 (+) Marker Load Pipeline mRatBN7.2 6 72,593,596 - 72,593,685 (+) MAPPER mRatBN7.2 Rnor_6.0 6 76,002,643 - 76,002,731 NCBI Rnor6.0 Rnor_5.0 6 85,538,356 - 85,538,444 UniSTS Rnor5.0 RGSC_v3.4 6 75,462,022 - 75,462,111 RGD RGSC3.4 RGSC_v3.4 6 75,462,023 - 75,462,111 UniSTS RGSC3.4 RGSC_v3.1 6 75,465,149 - 75,465,237 RGD Celera 6 71,434,873 - 71,434,961 UniSTS RH 2.0 Map 6 698.7 RGD SHRSP x BN Map 6 47.8099 RGD FHH x ACI Map 6 56.9999 RGD Cytogenetic Map 6 q23 UniSTS
D6Got311
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 72,604,632 - 72,604,860 (+) MAPPER mRatBN7.2 Rnor_6.0 6 76,013,618 - 76,013,845 NCBI Rnor6.0 Rnor_5.0 6 85,549,608 - 85,549,835 UniSTS Rnor5.0 RGSC_v3.4 6 75,473,358 - 75,473,585 UniSTS RGSC3.4 Celera 6 71,445,833 - 71,446,060 UniSTS Cytogenetic Map 6 q23 UniSTS
RH128735
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 72,624,967 - 72,625,149 (+) MAPPER mRatBN7.2 Rnor_6.0 6 76,033,858 - 76,034,039 NCBI Rnor6.0 Rnor_5.0 6 85,570,203 - 85,570,384 UniSTS Rnor5.0 RGSC_v3.4 6 75,493,773 - 75,493,954 UniSTS RGSC3.4 Celera 6 71,466,272 - 71,466,453 UniSTS Cytogenetic Map 6 q23 UniSTS
RH144431
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 72,626,550 - 72,626,805 (+) MAPPER mRatBN7.2 Rnor_6.0 6 76,035,441 - 76,035,695 NCBI Rnor6.0 Rnor_5.0 6 85,571,786 - 85,572,040 UniSTS Rnor5.0 RGSC_v3.4 6 75,495,356 - 75,495,610 UniSTS RGSC3.4 Celera 6 71,467,855 - 71,468,109 UniSTS Cytogenetic Map 6 q23 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000052076 ⟹ ENSRNOP00000048945
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 72,587,605 - 72,625,189 (+) Ensembl Rnor_6.0 Ensembl 6 75,996,643 - 76,034,083 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000098782 ⟹ ENSRNOP00000085749
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 72,587,630 - 72,625,181 (+) Ensembl
RefSeq Acc Id:
NM_053871 ⟹ NP_446323
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 78,322,753 - 78,360,348 (+) NCBI mRatBN7.2 6 72,587,597 - 72,625,196 (+) NCBI Rnor_6.0 6 75,996,643 - 76,034,086 (+) NCBI Rnor_5.0 6 85,532,350 - 85,572,100 (+) NCBI RGSC_v3.4 6 75,446,838 - 75,494,001 (+) RGD Celera 6 71,428,873 - 71,466,500 (+) RGD
Sequence:
GGTTCGGTGGCAGTCGTCGGTATTCCAGCTGGTGGGAGTTGGCTTAAGGGTGCTGGGCTCTGGGCCCCTAGTTTATGTAGCTGGGAAGTTGGACTGCGTGGTCTTCCCTGTCCTTCTGCTTCCAGTGT
hide sequence
RefSeq Acc Id:
XM_006240097 ⟹ XP_006240159
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 78,322,308 - 78,362,017 (+) NCBI mRatBN7.2 6 72,587,622 - 72,625,196 (+) NCBI Rnor_6.0 6 75,996,629 - 76,035,768 (+) NCBI Rnor_5.0 6 85,532,350 - 85,572,100 (+) NCBI
Sequence:
CTCATTGGGCGGAAGGTTCGGTGGCAGTCGTCGGTATTCCAGCTGGTGGGAGTTGGCTTAAGGGTGCTGGGCTCTGGGCCCCTAGTTTATGTAGCTGGGAAGTTGGACTGCGTGGTCTTCCCTGTCCT
hide sequence
RefSeq Acc Id:
NP_446323 ⟸ NM_053871
- UniProtKB:
Q6AYB5 (UniProtKB/Swiss-Prot), A0A8I6A4J0 (UniProtKB/TrEMBL)
- Sequence:
MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYFYQRK
hide sequence
RefSeq Acc Id:
XP_006240159 ⟸ XM_006240097
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6A4J0 (UniProtKB/TrEMBL)
- Sequence:
MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYFYQRK
hide sequence
Ensembl Acc Id:
ENSRNOP00000048945 ⟸ ENSRNOT00000052076
Ensembl Acc Id:
ENSRNOP00000085749 ⟸ ENSRNOT00000098782
RGD ID: 13694602 Promoter ID: EPDNEW_R5126 Type: initiation region Name: Srp54a_1 Description: signal recognition particle 54A SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 75,996,654 - 75,996,714 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-11-19
Srp54a
signal recognition particle 54A
Srp54a
signal recognition particle 54kDa
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-11-11
Srp54a
signal recognition particle 54kDa
Srp54
signal recognition particle 54A
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-02-03
Srp54
signal recognition particle 54A
Srp54a
signal recognition particle 54a
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-05-15
Srp54a
signal recognition particle 54a
Srp54
signal recognition particle 54
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-07-08
Srp54
signal recognition particle 54
signal recognition particle 54 kDa
Name updated
1299863 APPROVED
2002-08-07
Srp54
signal recognition particle 54 kDa
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
mRNA expression increases in preosteoblastic cells subcultured on collagen compared with subculture on plastic only
634092
