Symbol:
Gpd1
Name:
glycerol-3-phosphate dehydrogenase 1
RGD ID:
621381
Description:
Enables NAD binding activity and glycerol-3-phosphate dehydrogenase (quinone) activity. Involved in NADH oxidation; glycerol-3-phosphate metabolic process; and glycerolipid metabolic process. Predicted to be located in cytoplasm. Predicted to be active in cytosol. Orthologous to human GPD1 (glycerol-3-phosphate dehydrogenase 1); PARTICIPATES IN D-glycericacidemia pathway; electron transport chain pathway; familial lipoprotein lipase deficiency pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
glycerol 3-phosphate dehydrogenase; glycerol-3-phosphate dehydrogenase 1 (soluble); glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic; glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; GPD-C; Gpd3; GPDH; GPDH-C; MGC93453
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 132,722,982 - 132,730,373 (+) NCBI GRCr8 mRatBN7.2 7 130,842,526 - 130,851,530 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 130,844,138 - 130,851,529 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 132,647,629 - 132,655,240 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 134,873,210 - 134,880,821 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 134,785,735 - 134,793,346 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 141,368,928 - 141,377,931 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 141,370,491 - 141,377,928 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 115,874,138 - 115,882,579 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 138,458,875 - 138,466,266 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 138,535,311 - 138,542,700 (+) NCBI Celera 7 127,325,535 - 127,332,926 (+) NCBI Celera Cytogenetic Map 7 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gpd1 Rat (1->4)-beta-D-glucan multiple interactions ISO Gpd1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of GPD1 mRNA CTD PMID:36331819 Gpd1 Rat 1,2-dimethylhydrazine decreases expression ISO Gpd1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of GPD1 mRNA CTD PMID:22206623 Gpd1 Rat 17beta-estradiol decreases expression ISO GPD1 (Homo sapiens) 6480464 Estradiol results in decreased expression of GPD1 mRNA CTD PMID:20106945 Gpd1 Rat 17beta-estradiol increases expression ISO Gpd1 (Mus musculus) 6480464 Estradiol results in increased expression of GPD1 mRNA CTD PMID:39298647 Gpd1 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of GPD1 mRNA CTD PMID:32145629 Gpd1 Rat 17beta-estradiol decreases expression ISO Gpd1 (Mus musculus) 6480464 Estradiol results in decreased expression of GPD1 mRNA CTD PMID:19484750 Gpd1 Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one multiple interactions ISO Gpd1 (Mus musculus) 6480464 Metribolone inhibits the reaction [Ketoconazole results in decreased expression of GPD1 mRNA] CTD PMID:19587329 Gpd1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of GPD1 mRNA CTD PMID:22298810 Gpd1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Gpd1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of GPD1 mRNA CTD PMID:28922406 Gpd1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO GPD1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of GPD1 mRNA CTD PMID:20106945 more ... Gpd1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases activity ISO Gpd1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased activity of GPD1 protein CTD PMID:10497882 Gpd1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Gpd1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin inhibits the reaction [Dehydroepiandrosterone results in increased activity of GPD1 protein] CTD PMID:10497882 Gpd1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Gpd1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Gpd1 Rat 2,4-dinitrotoluene decreases expression ISO Gpd1 (Mus musculus) 6480464 2 and 4-dinitrotoluene results in decreased expression of GPD1 mRNA CTD PMID:24893713 Gpd1 Rat 3-aminobenzoic acid multiple interactions ISO Gpd1 (Mus musculus) 6480464 [INS1 protein co-treated with 3-aminobenzoic acid] results in increased activity of GPD1 protein CTD PMID:2523799 Gpd1 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin analog results in decreased expression of GPD1 protein and alpha-Chlorohydrin results in decreased expression of GPD1 protein CTD PMID:26597043 Gpd1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Gpd1 (Mus musculus) 6480464 [INS1 protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine] results in increased activity of GPD1 protein more ... CTD PMID:11101056 and PMID:2523799 Gpd1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO GPD1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of GPD1 mRNA CTD PMID:28628672 Gpd1 Rat 3H-1,2-dithiole-3-thione increases expression EXP 6480464 1 and 2-dithiol-3-thione results in increased expression of GPD1 mRNA CTD PMID:19162173 Gpd1 Rat 4,4'-sulfonyldiphenol increases expression ISO GPD1 (Homo sapiens) 6480464 bisphenol S results in increased expression of GPD1 mRNA and bisphenol S results in increased expression of GPD1 protein CTD PMID:27685785 and PMID:34186270 Gpd1 Rat 4,4'-sulfonyldiphenol affects expression ISO Gpd1 (Mus musculus) 6480464 bisphenol S affects the expression of GPD1 mRNA CTD PMID:39298647 Gpd1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of GPD1 mRNA CTD PMID:24780913 and PMID:25825206 Gpd1 Rat aflatoxin B1 affects expression ISO GPD1 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of GPD1 protein CTD PMID:20106945 Gpd1 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of GPD1 mRNA CTD PMID:33354967 Gpd1 Rat aflatoxin B1 increases methylation ISO GPD1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of GPD1 intron CTD PMID:30157460 Gpd1 Rat aflatoxin B1 decreases expression ISO GPD1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of GPD1 mRNA CTD PMID:21641981 more ... Gpd1 Rat aldehydo-D-glucose increases expression EXP 6480464 Glucose results in increased expression of GPD1 mRNA CTD PMID:3299706 Gpd1 Rat all-trans-retinoic acid decreases expression ISO Gpd1 (Mus musculus) 6480464 Tretinoin results in decreased expression of GPD1 mRNA CTD PMID:16604517 Gpd1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of GPD1 mRNA CTD PMID:35163327 Gpd1 Rat aluminium atom multiple interactions ISO GPD1 (Homo sapiens) 6480464 Aluminum results in increased expression of and results in increased activity of GPD1 protein CTD PMID:17762189 Gpd1 Rat aluminium(0) multiple interactions ISO GPD1 (Homo sapiens) 6480464 Aluminum results in increased expression of and results in increased activity of GPD1 protein CTD PMID:17762189 Gpd1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of GPD1 mRNA CTD PMID:16483693 Gpd1 Rat aristolochic acid A increases expression ISO GPD1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of GPD1 mRNA CTD PMID:33212167 Gpd1 Rat arsenous acid multiple interactions ISO GPD1 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to GPD1 protein] CTD PMID:26598702 Gpd1 Rat benzamide multiple interactions ISO Gpd1 (Mus musculus) 6480464 [INS1 protein co-treated with benzamide] results in increased activity of GPD1 protein more ... CTD PMID:2523799 Gpd1 Rat benzo[a]pyrene decreases expression ISO GPD1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of GPD1 mRNA CTD PMID:20106945 and PMID:32234424 Gpd1 Rat benzo[a]pyrene increases methylation ISO GPD1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of GPD1 3' UTR and Benzo(a)pyrene results in increased methylation of GPD1 5' UTR CTD PMID:27901495 Gpd1 Rat benzo[a]pyrene affects methylation ISO GPD1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of GPD1 promoter CTD PMID:27901495 Gpd1 Rat benzo[a]pyrene decreases expression ISO Gpd1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of GPD1 mRNA CTD PMID:22228805 Gpd1 Rat benzo[a]pyrene multiple interactions ISO Gpd1 (Mus musculus) 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of GPD1 mRNA] CTD PMID:22228805 Gpd1 Rat benzo[b]fluoranthene decreases expression ISO Gpd1 (Mus musculus) 6480464 benzo(b)fluoranthene results in decreased expression of GPD1 mRNA CTD PMID:26377693 Gpd1 Rat benzo[e]pyrene increases methylation ISO GPD1 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of GPD1 intron CTD PMID:30157460 Gpd1 Rat benzoates multiple interactions ISO Gpd1 (Mus musculus) 6480464 [INS1 protein co-treated with Benzoates] results in increased activity of GPD1 protein CTD PMID:2523799 Gpd1 Rat bexarotene increases expression EXP 6480464 bexarotene results in increased expression of GPD1 mRNA CTD PMID:23292798 Gpd1 Rat bezafibrate increases expression ISO Gpd1 (Mus musculus) 6480464 Bezafibrate results in increased expression of GPD1 mRNA CTD PMID:1976021 Gpd1 Rat bezafibrate multiple interactions ISO Gpd1 (Mus musculus) 6480464 Bucladesine promotes the reaction [Bezafibrate results in increased expression of GPD1 mRNA] CTD PMID:1976021 Gpd1 Rat bicalutamide decreases expression ISO Gpd1 (Mus musculus) 6480464 bicalutamide results in decreased expression of GPD1 mRNA CTD PMID:19587329 Gpd1 Rat bicalutamide multiple interactions ISO Gpd1 (Mus musculus) 6480464 FSHB protein inhibits the reaction [bicalutamide results in decreased expression of GPD1 protein] CTD PMID:19587329 Gpd1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Gpd1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of GPD1 mRNA CTD PMID:39150890 Gpd1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Gpd1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of GPD1 mRNA CTD PMID:37810885 Gpd1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of GPD1 mRNA CTD PMID:25181051 and PMID:30903817 Gpd1 Rat bisphenol A decreases expression ISO GPD1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of GPD1 protein CTD PMID:34186270 Gpd1 Rat bisphenol A increases expression ISO Gpd1 (Mus musculus) 6480464 bisphenol A results in increased expression of GPD1 mRNA CTD PMID:32156529 Gpd1 Rat bisphenol A decreases expression ISO Gpd1 (Mus musculus) 6480464 bisphenol A results in decreased expression of GPD1 mRNA CTD PMID:33221593 Gpd1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GPD1 mRNA CTD PMID:30816183 Gpd1 Rat bisphenol AF increases expression ISO GPD1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of GPD1 protein CTD PMID:34186270 Gpd1 Rat Bisphenol B increases expression ISO GPD1 (Homo sapiens) 6480464 bisphenol B results in increased expression of GPD1 protein CTD PMID:34186270 Gpd1 Rat bisphenol F increases expression ISO GPD1 (Homo sapiens) 6480464 bisphenol F results in increased expression of GPD1 protein CTD PMID:34186270 Gpd1 Rat bromobenzene affects binding EXP 6480464 bromobenzene metabolite binds to GPD1 protein CTD PMID:17305373 Gpd1 Rat bucladesine multiple interactions ISO Gpd1 (Mus musculus) 6480464 Bucladesine promotes the reaction [Bezafibrate results in increased expression of GPD1 mRNA] CTD PMID:1976021 Gpd1 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of GPD1 mRNA CTD PMID:24136188 Gpd1 Rat Butylbenzyl phthalate multiple interactions ISO Gpd1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of GPD1 mRNA CTD PMID:39150890 Gpd1 Rat cadmium atom decreases activity ISO Gpd1 (Mus musculus) 6480464 Cadmium results in decreased activity of GPD1 protein CTD PMID:21848503 Gpd1 Rat cadmium atom multiple interactions ISO GPD1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of GPD1 mRNA CTD PMID:35301059 Gpd1 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of GPD1 mRNA CTD PMID:25993096 Gpd1 Rat cadmium dichloride multiple interactions ISO GPD1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of GPD1 mRNA CTD PMID:35301059 Gpd1 Rat carbon nanotube decreases expression ISO Gpd1 (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of GPD1 mRNA CTD PMID:25554681 Gpd1 Rat celastrol affects activity ISO Gpd1 (Mus musculus) 6480464 celastrol affects the activity of GPD1 protein CTD PMID:27085773 Gpd1 Rat chlordecone increases expression ISO Gpd1 (Mus musculus) 6480464 Chlordecone results in increased expression of GPD1 mRNA CTD PMID:33711761 Gpd1 Rat cisplatin multiple interactions ISO GPD1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of GPD1 mRNA CTD PMID:27392435 Gpd1 Rat clobetasol increases expression ISO Gpd1 (Mus musculus) 6480464 Clobetasol results in increased expression of GPD1 mRNA CTD PMID:27462272 Gpd1 Rat clofibrate multiple interactions ISO Gpd1 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of GPD1 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of GPD1 mRNA] CTD PMID:17585979 Gpd1 Rat clofibrate increases expression ISO Gpd1 (Mus musculus) 6480464 Clofibrate results in increased expression of GPD1 mRNA CTD PMID:23811191 Gpd1 Rat clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of GPD1 mRNA and Clofibrate results in increased expression of GPD1 protein CTD PMID:12851107 and PMID:16470657 Gpd1 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of GPD1 mRNA CTD PMID:24386269 Gpd1 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of GPD1 mRNA CTD PMID:26577399 and PMID:27523638 Gpd1 Rat cyclosporin A decreases expression ISO GPD1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of GPD1 mRNA CTD PMID:20106945 Gpd1 Rat cyproconazole decreases expression ISO GPD1 (Homo sapiens) 6480464 cyproconazole results in decreased expression of GPD1 protein CTD PMID:29995386 Gpd1 Rat D-glucose increases expression EXP 6480464 Glucose results in increased expression of GPD1 mRNA CTD PMID:3299706 Gpd1 Rat dehydroepiandrosterone increases activity ISO Gpd1 (Mus musculus) 6480464 Dehydroepiandrosterone results in increased activity of GPD1 protein CTD PMID:10497882 Gpd1 Rat dehydroepiandrosterone multiple interactions ISO Gpd1 (Mus musculus) 6480464 benz(a)anthracene inhibits the reaction [Dehydroepiandrosterone results in increased activity of GPD1 protein] and Tetrachlorodibenzodioxin inhibits the reaction [Dehydroepiandrosterone results in increased activity of GPD1 protein] CTD PMID:10497882 Gpd1 Rat dexamethasone multiple interactions ISO Gpd1 (Mus musculus) 6480464 [INS1 protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine] results in increased activity of GPD1 protein more ... CTD PMID:11101056 and PMID:2523799 Gpd1 Rat dexamethasone multiple interactions ISO GPD1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of GPD1 mRNA CTD PMID:28628672 Gpd1 Rat dexamethasone increases expression ISO GPD1 (Homo sapiens) 6480464 Dexamethasone results in increased expression of GPD1 mRNA CTD PMID:25047013 Gpd1 Rat diarsenic trioxide multiple interactions ISO GPD1 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to GPD1 protein] CTD PMID:26598702 Gpd1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of GPD1 mRNA CTD PMID:21266533 Gpd1 Rat dibutyl phthalate multiple interactions ISO Gpd1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of GPD1 mRNA CTD PMID:39150890 Gpd1 Rat dichloroacetic acid increases expression ISO Gpd1 (Mus musculus) 6480464 Dichloroacetic Acid results in increased expression of GPD1 mRNA CTD PMID:28962523 Gpd1 Rat diclofenac multiple interactions EXP 6480464 Diclofenac inhibits the reaction [lipopolysaccharide and E coli O55-B5 results in increased expression of GPD1 protein] CTD PMID:25772430 Gpd1 Rat diethyl phthalate multiple interactions ISO Gpd1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of GPD1 mRNA CTD PMID:39150890 Gpd1 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of GPD1 mRNA CTD PMID:37077353 Gpd1 Rat diisobutyl phthalate multiple interactions ISO Gpd1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of GPD1 mRNA CTD PMID:39150890 Gpd1 Rat diisononyl phthalate multiple interactions ISO Gpd1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of GPD1 mRNA CTD PMID:39150890 Gpd1 Rat diquat increases expression ISO Gpd1 (Mus musculus) 6480464 Diquat results in increased expression of GPD1 mRNA CTD PMID:36851058 Gpd1 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of GPD1 mRNA CTD PMID:25152437 Gpd1 Rat epoxiconazole increases expression EXP 6480464 epoxiconazole results in increased expression of GPD1 mRNA CTD PMID:29038839 Gpd1 Rat epoxiconazole decreases expression ISO Gpd1 (Mus musculus) 6480464 epoxiconazole results in decreased expression of GPD1 mRNA CTD PMID:35436446 Gpd1 Rat ethanol decreases expression ISO Gpd1 (Mus musculus) 6480464 Ethanol results in decreased expression of GPD1 mRNA CTD PMID:15513904 Gpd1 Rat fluoxetine increases expression EXP 6480464 Fluoxetine results in increased expression of GPD1 mRNA CTD PMID:17033635 Gpd1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of GPD1 mRNA CTD PMID:24136188 Gpd1 Rat fructose increases expression EXP 6480464 Fructose results in increased expression of GPD1 mRNA CTD PMID:36049592 Gpd1 Rat furan increases methylation EXP 6480464 furan results in increased methylation of GPD1 gene CTD PMID:22079235 Gpd1 Rat furan affects binding EXP 6480464 furan binds to GPD1 protein CTD PMID:22240984 Gpd1 Rat genistein decreases expression ISO Gpd1 (Mus musculus) 6480464 Genistein results in decreased expression of GPD1 mRNA CTD PMID:32186404 Gpd1 Rat glucose increases expression EXP 6480464 Glucose results in increased expression of GPD1 mRNA CTD PMID:3299706 Gpd1 Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of GPD1 mRNA CTD PMID:24915197 Gpd1 Rat hydrazines decreases expression ISO Gpd1 (Mus musculus) 6480464 Hydrazines results in decreased expression of GPD1 mRNA CTD PMID:21647536 Gpd1 Rat hydrogen cyanide decreases expression ISO Gpd1 (Mus musculus) 6480464 Hydrogen Cyanide results in decreased expression of GPD1 mRNA CTD PMID:33914522 Gpd1 Rat Indeno[1,2,3-cd]pyrene decreases expression ISO Gpd1 (Mus musculus) 6480464 indeno(1 more ... CTD PMID:26377693 Gpd1 Rat indometacin multiple interactions ISO GPD1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of GPD1 mRNA CTD PMID:28628672 Gpd1 Rat ketoconazole decreases expression ISO Gpd1 (Mus musculus) 6480464 Ketoconazole results in decreased expression of GPD1 mRNA CTD PMID:19587329 Gpd1 Rat ketoconazole increases expression EXP 6480464 Ketoconazole results in increased expression of GPD1 mRNA CTD PMID:37077353 Gpd1 Rat ketoconazole multiple interactions ISO Gpd1 (Mus musculus) 6480464 Ketoconazole inhibits the reaction [FSHB protein results in increased expression of GPD1 mRNA] and Metribolone inhibits the reaction [Ketoconazole results in decreased expression of GPD1 mRNA] CTD PMID:19587329 Gpd1 Rat L-ascorbic acid multiple interactions EXP 6480464 [Ascorbic Acid co-treated with INS1 protein] results in decreased expression of GPD1 mRNA CTD PMID:20400526 Gpd1 Rat lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of GPD1 mRNA CTD PMID:22641619 Gpd1 Rat leflunomide decreases expression ISO Gpd1 (Mus musculus) 6480464 leflunomide results in decreased expression of GPD1 mRNA CTD PMID:19751817 Gpd1 Rat levofloxacin decreases expression EXP 6480464 Levofloxacin results in decreased expression of GPD1 mRNA CTD PMID:24136188 Gpd1 Rat lithium atom increases activity EXP 6480464 Lithium results in increased activity of GPD1 protein CTD PMID:3224025 Gpd1 Rat lithium hydride increases activity EXP 6480464 Lithium results in increased activity of GPD1 protein CTD PMID:3224025 Gpd1 Rat Mesaconitine increases expression EXP 6480464 mesaconitine results in increased expression of GPD1 protein CTD PMID:37182599 Gpd1 Rat methapyrilene increases methylation ISO GPD1 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of GPD1 intron CTD PMID:30157460 Gpd1 Rat Methylazoxymethanol acetate increases expression EXP 6480464 Methylazoxymethanol Acetate results in increased expression of GPD1 mRNA CTD PMID:28349193 Gpd1 Rat mono(2-ethylhexyl) phthalate increases expression ISO Gpd1 (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of GPD1 protein CTD PMID:27384973 Gpd1 Rat N-nitrosomorpholine affects expression EXP 6480464 N-nitrosomorpholine affects the expression of GPD1 protein CTD PMID:19716841 Gpd1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of GPD1 mRNA CTD PMID:24136188 Gpd1 Rat nickel atom decreases expression ISO GPD1 (Homo sapiens) 6480464 Nickel results in decreased expression of GPD1 mRNA CTD PMID:24768652 and PMID:25583101 Gpd1 Rat nicotinic acid multiple interactions ISO Gpd1 (Mus musculus) 6480464 [INS1 protein co-treated with Niacin] results in increased activity of GPD1 protein CTD PMID:2523799 Gpd1 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of GPD1 mRNA CTD PMID:33484710 Gpd1 Rat Nonylphenol decreases expression EXP 6480464 nonylphenol results in decreased expression of GPD1 protein CTD PMID:19260726 Gpd1 Rat O-methyleugenol decreases expression ISO GPD1 (Homo sapiens) 6480464 methyleugenol results in decreased expression of GPD1 mRNA CTD PMID:32234424 Gpd1 Rat obeticholic acid decreases expression ISO GPD1 (Homo sapiens) 6480464 obeticholic acid results in decreased expression of GPD1 mRNA CTD PMID:27939613 Gpd1 Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of GPD1 mRNA CTD PMID:25729387 Gpd1 Rat ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of GPD1 mRNA CTD PMID:37088303 Gpd1 Rat paracetamol multiple interactions ISO Gpd1 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of GPD1 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of GPD1 mRNA] CTD PMID:17585979 Gpd1 Rat paracetamol decreases expression ISO Gpd1 (Mus musculus) 6480464 Acetaminophen results in decreased expression of GPD1 protein CTD PMID:22939915 Gpd1 Rat paracetamol decreases expression ISO GPD1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of GPD1 mRNA CTD PMID:21420995 Gpd1 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of GPD1 mRNA CTD PMID:32680482 Gpd1 Rat perfluorododecanoic acid increases expression EXP 6480464 perfluorododecanoic acid results in increased expression of GPD1 protein CTD PMID:26168851 Gpd1 Rat perfluorononanoic acid decreases expression ISO GPD1 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of GPD1 mRNA CTD PMID:32588087 Gpd1 Rat perfluorooctane-1-sulfonic acid increases expression EXP 6480464 perfluorooctane sulfonic acid results in increased expression of GPD1 mRNA CTD PMID:19162173 Gpd1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Gpd1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of GPD1 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of GPD1 mRNA CTD PMID:36331819 Gpd1 Rat perfluorooctane-1-sulfonic acid decreases expression ISO GPD1 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of GPD1 mRNA CTD PMID:32588087 Gpd1 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of GPD1 mRNA and perfluorooctanoic acid results in increased expression of GPD1 protein CTD PMID:16221955 and PMID:34958885 Gpd1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of GPD1 mRNA CTD PMID:35163327 Gpd1 Rat permethrin increases expression EXP 6480464 Permethrin results in increased expression of GPD1 mRNA CTD PMID:19017407 Gpd1 Rat phorbol 13-acetate 12-myristate multiple interactions ISO Gpd1 (Mus musculus) 6480464 Tetradecanoylphorbol Acetate inhibits the reaction [[INS1 protein co-treated with benzamide] results in increased activity of GPD1 protein] CTD PMID:2523799 Gpd1 Rat picrotoxin decreases expression EXP 6480464 Picrotoxin results in decreased expression of GPD1 mRNA CTD PMID:15170462 Gpd1 Rat pirinixic acid multiple interactions ISO Gpd1 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of GPD1 mRNA CTD PMID:19710929 Gpd1 Rat pirinixic acid increases expression ISO Gpd1 (Mus musculus) 6480464 pirinixic acid results in increased expression of GPD1 mRNA CTD PMID:16357043 more ... Gpd1 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of GPD1 mRNA CTD PMID:19162173 and PMID:22484513 Gpd1 Rat potassium cyanide increases expression ISO Gpd1 (Mus musculus) 6480464 Potassium Cyanide results in increased expression of GPD1 mRNA CTD PMID:33914522 Gpd1 Rat pregnenolone 16alpha-carbonitrile decreases expression ISO Gpd1 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in decreased expression of GPD1 mRNA CTD PMID:28903501 Gpd1 Rat progesterone affects expression ISO Gpd1 (Mus musculus) 6480464 Progesterone affects the expression of GPD1 mRNA CTD PMID:17251523 Gpd1 Rat propiconazole multiple interactions ISO GPD1 (Homo sapiens) 6480464 [propiconazole co-treated with tebuconazole] results in increased expression of GPD1 mRNA CTD PMID:30989312 Gpd1 Rat propiconazole decreases expression ISO GPD1 (Homo sapiens) 6480464 propiconazole results in decreased expression of GPD1 mRNA CTD PMID:30989312 Gpd1 Rat resveratrol multiple interactions EXP 6480464 [resveratrol co-treated with Streptozocin] results in decreased expression of GPD1 mRNA CTD PMID:25905778 Gpd1 Rat resveratrol multiple interactions ISO GPD1 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of GPD1 mRNA CTD PMID:23557933 Gpd1 Rat ritonavir multiple interactions ISO Gpd1 (Mus musculus) 6480464 Ritonavir promotes the reaction [[INS1 protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine] results in increased expression of GPD1 protein] CTD PMID:11101056 Gpd1 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of GPD1 mRNA CTD PMID:28374803 Gpd1 Rat sodium arsenite increases expression ISO Gpd1 (Mus musculus) 6480464 sodium arsenite results in increased expression of GPD1 protein CTD PMID:29044176 Gpd1 Rat sodium arsenite decreases expression ISO Gpd1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of GPD1 mRNA CTD PMID:37682722 Gpd1 Rat sodium arsenite decreases expression ISO GPD1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of GPD1 mRNA CTD PMID:29301061 Gpd1 Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of GPD1 protein CTD PMID:29459688 Gpd1 Rat streptozocin multiple interactions EXP 6480464 [resveratrol co-treated with Streptozocin] results in decreased expression of GPD1 mRNA CTD PMID:25905778 Gpd1 Rat sunitinib decreases expression ISO GPD1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of GPD1 mRNA CTD PMID:31533062 Gpd1 Rat tebuconazole multiple interactions ISO GPD1 (Homo sapiens) 6480464 [propiconazole co-treated with tebuconazole] results in increased expression of GPD1 mRNA CTD PMID:30989312 Gpd1 Rat tebuconazole increases expression ISO GPD1 (Homo sapiens) 6480464 tebuconazole results in increased expression of GPD1 mRNA CTD PMID:30989312 Gpd1 Rat Tesaglitazar increases expression EXP 6480464 tesaglitazar results in increased expression of GPD1 mRNA CTD PMID:21515302 Gpd1 Rat testosterone increases expression ISO GPD1 (Homo sapiens) 6480464 Testosterone results in increased expression of GPD1 mRNA CTD PMID:33359661 Gpd1 Rat tetracycline decreases expression ISO Gpd1 (Mus musculus) 6480464 Tetracycline results in decreased expression of GPD1 mRNA CTD PMID:24489787 Gpd1 Rat tetraphene multiple interactions ISO Gpd1 (Mus musculus) 6480464 benz(a)anthracene inhibits the reaction [Dehydroepiandrosterone results in increased activity of GPD1 protein] CTD PMID:10497882 Gpd1 Rat tetraphene increases activity ISO Gpd1 (Mus musculus) 6480464 benz(a)anthracene results in increased activity of GPD1 protein CTD PMID:10497882 Gpd1 Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of GPD1 protein CTD PMID:35544339 Gpd1 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of GPD1 mRNA CTD PMID:25729387 Gpd1 Rat triptonide increases expression ISO Gpd1 (Mus musculus) 6480464 triptonide results in increased expression of GPD1 mRNA CTD PMID:33045310 Gpd1 Rat tris(2-butoxyethyl) phosphate affects expression ISO GPD1 (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of GPD1 mRNA CTD PMID:29024780 Gpd1 Rat triticonazole increases expression EXP 6480464 triticonazole results in increased expression of GPD1 mRNA CTD PMID:36084822 Gpd1 Rat troglitazone increases expression EXP 6480464 troglitazone results in increased expression of GPD1 protein CTD PMID:21315101 Gpd1 Rat urethane decreases expression ISO GPD1 (Homo sapiens) 6480464 Urethane results in decreased expression of GPD1 mRNA CTD PMID:28818685 Gpd1 Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of GPD1 mRNA CTD PMID:24136188 Gpd1 Rat valproic acid decreases expression ISO GPD1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of GPD1 mRNA CTD PMID:29154799 and PMID:29501571 Gpd1 Rat valproic acid increases expression ISO Gpd1 (Mus musculus) 6480464 Valproic Acid results in increased expression of GPD1 mRNA CTD PMID:24489787 Gpd1 Rat vancomycin increases expression ISO Gpd1 (Mus musculus) 6480464 Vancomycin results in increased expression of GPD1 mRNA CTD PMID:18930951 Gpd1 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of GPD1 mRNA CTD PMID:19015723
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (ISO) 3-aminobenzoic acid (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (EXP,ISO) aldehydo-D-glucose (EXP) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) aluminium atom (ISO) aluminium(0) (ISO) ammonium chloride (EXP) aristolochic acid A (ISO) arsenous acid (ISO) benzamide (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) benzo[e]pyrene (ISO) benzoates (ISO) bexarotene (EXP) bezafibrate (ISO) bicalutamide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bromobenzene (EXP) bucladesine (ISO) buspirone (EXP) Butylbenzyl phthalate (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) carbon nanotube (ISO) celastrol (ISO) chlordecone (ISO) cisplatin (ISO) clobetasol (ISO) clofibrate (EXP,ISO) cobalt dichloride (EXP) Cuprizon (EXP) cyclosporin A (ISO) cyproconazole (ISO) D-glucose (EXP) dehydroepiandrosterone (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) dibutyl phthalate (EXP,ISO) dichloroacetic acid (ISO) diclofenac (EXP) diethyl phthalate (ISO) diethylstilbestrol (EXP) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) diquat (ISO) diuron (EXP) epoxiconazole (EXP,ISO) ethanol (ISO) fluoxetine (EXP) flutamide (EXP) fructose (EXP) furan (EXP) genistein (ISO) glucose (EXP) glycidol (EXP) hydrazines (ISO) hydrogen cyanide (ISO) Indeno[1,2,3-cd]pyrene (ISO) indometacin (ISO) ketoconazole (EXP,ISO) L-ascorbic acid (EXP) lead diacetate (EXP) leflunomide (ISO) levofloxacin (EXP) lithium atom (EXP) lithium hydride (EXP) Mesaconitine (EXP) methapyrilene (ISO) Methylazoxymethanol acetate (EXP) mono(2-ethylhexyl) phthalate (ISO) N-nitrosomorpholine (EXP) nefazodone (EXP) nickel atom (ISO) nicotinic acid (ISO) nitrofen (EXP) Nonylphenol (EXP) O-methyleugenol (ISO) obeticholic acid (ISO) oxaliplatin (EXP) ozone (EXP) paracetamol (ISO) paraquat (EXP) perfluorododecanoic acid (EXP) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluorooctanoic acid (EXP) permethrin (EXP) phorbol 13-acetate 12-myristate (ISO) picrotoxin (EXP) pirinixic acid (EXP,ISO) potassium cyanide (ISO) pregnenolone 16alpha-carbonitrile (ISO) progesterone (ISO) propiconazole (ISO) resveratrol (EXP,ISO) ritonavir (ISO) rotenone (EXP) sodium arsenite (EXP,ISO) streptozocin (EXP) sunitinib (ISO) tebuconazole (ISO) Tesaglitazar (EXP) testosterone (ISO) tetracycline (ISO) tetraphene (ISO) thapsigargin (EXP) topotecan (EXP) triptonide (ISO) tris(2-butoxyethyl) phosphate (ISO) triticonazole (EXP) troglitazone (EXP) urethane (ISO) valdecoxib (EXP) valproic acid (ISO) vancomycin (ISO) vinclozolin (EXP)
1.
Key enzymes of carbohydrate metabolism as targets of the 11.5-kDa Zn(2+)-binding protein (parathymosin).
Brand IA and Heinickel A, J Biol Chem. 1991 Nov 5;266(31):20984-9.
2.
Dramatic enhancement of the specific expression of the heart-type fatty acid binding protein in rat brown adipose tissue by cold exposure.
Daikoku T, etal., FEBS Lett 1997 Jun 30;410(2-3):383-6.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Neuronal and astrocytic shuttle mechanisms for cytosolic-mitochondrial transfer of reducing equivalents: current evidence and pharmacological tools.
McKenna MC, etal., Biochem Pharmacol. 2006 Feb 14;71(4):399-407. Epub 2005 Dec 20.
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
9.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
10.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
11.
Normal myelin composition and phospholipid synthesis in adrenalectomized rats with reduced brain myelin and glycerol 3-phosphate dehydrogenase activity.
Preston SL and McMorris FA, J Neurochem. 1985 Dec;45(6):1771-8.
12.
GOA pipeline
RGD automated data pipeline
13.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
Arachidonic acid metabolites of the lipoxygenase as well as the cyclooxygenase pathway may be involved in regulating preadipocyte differentiation.
Shillabeer G, etal., Metabolism. 1998 Apr;47(4):461-6.
16.
Role of NADH shuttles in glucose-induced insulin secretion from fetal beta-cells.
Tan C, etal., Diabetes. 2002 Oct;51(10):2989-96.
17.
Testis-specific expression of rat mitochondrial glycerol-3-phosphate dehydrogenase in haploid male germ cells.
Weitzel JM, etal., Biol Reprod 2003 Feb;68(2):699-707.
18.
NAD+/NADH and NADP+/NADPH in cellular functions and cell death: regulation and biological consequences.
Ying W Antioxid Redox Signal. 2008 Feb;10(2):179-206.
Gpd1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 132,722,982 - 132,730,373 (+) NCBI GRCr8 mRatBN7.2 7 130,842,526 - 130,851,530 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 130,844,138 - 130,851,529 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 132,647,629 - 132,655,240 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 134,873,210 - 134,880,821 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 134,785,735 - 134,793,346 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 141,368,928 - 141,377,931 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 141,370,491 - 141,377,928 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 115,874,138 - 115,882,579 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 138,458,875 - 138,466,266 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 138,535,311 - 138,542,700 (+) NCBI Celera 7 127,325,535 - 127,332,926 (+) NCBI Celera Cytogenetic Map 7 q36 NCBI
GPD1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 50,104,008 - 50,111,313 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 50,103,982 - 50,111,313 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 50,497,791 - 50,505,096 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 48,784,068 - 48,791,363 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 48,784,067 - 48,791,360 NCBI Celera 12 49,293,286 - 49,300,582 (+) NCBI Celera Cytogenetic Map 12 q13.12 NCBI HuRef 12 47,530,923 - 47,538,425 (+) NCBI HuRef CHM1_1 12 50,463,752 - 50,471,253 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 50,067,090 - 50,074,395 (+) NCBI T2T-CHM13v2.0
Gpd1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 99,615,468 - 99,622,895 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 99,615,396 - 99,622,886 (+) Ensembl GRCm39 Ensembl GRCm38 15 99,717,587 - 99,725,014 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 99,717,515 - 99,725,005 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 99,548,024 - 99,555,439 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 99,545,627 - 99,553,042 (+) NCBI MGSCv36 mm8 Celera 15 101,873,405 - 101,880,780 (+) NCBI Celera Cytogenetic Map 15 F1 NCBI cM Map 15 56.13 NCBI
Gpd1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955547 676,342 - 690,777 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955547 676,661 - 683,906 (+) NCBI ChiLan1.0 ChiLan1.0
GPD1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 44,068,910 - 44,085,459 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 44,065,672 - 44,082,276 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 38,644,466 - 38,651,924 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 39,541,544 - 39,549,040 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 39,541,550 - 39,549,040 (-) Ensembl panpan1.1 panPan2
GPD1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 4,614,878 - 4,622,013 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 27 4,614,864 - 4,621,922 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 41,636,151 - 41,643,304 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 4,663,998 - 4,671,137 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 27 4,664,000 - 4,671,090 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 27 4,628,876 - 4,636,009 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 4,619,676 - 4,625,555 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 42,031,192 - 42,038,340 (+) NCBI UU_Cfam_GSD_1.0
Gpd1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 65,394,517 - 65,402,211 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936512 7,762,643 - 7,770,309 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936512 7,762,325 - 7,770,007 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GPD1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 16,007,448 - 16,017,825 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 16,008,179 - 16,021,676 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 16,330,841 - 16,334,498 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GPD1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 46,329,479 - 46,339,227 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 46,331,569 - 46,337,439 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 199,781,124 - 199,788,621 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gpd1
.
Predicted Target Of
Count of predictions: 697 Count of miRNA genes: 287 Interacting mature miRNAs: 369 Transcripts: ENSRNOT00000026199 Prediction methods: Microtar, Miranda, Pita, Pita,Targetscan, Targetscan Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 1354582 Stl11 Serum triglyceride level QTL 11 3.42 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 119513385 135012528 Rat 731176 Glom5 Glomerulus QTL 5 2.5 0.0035 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 7 96670164 135012528 Rat 1300112 Bp183 Blood pressure QTL 183 3.51 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 111182207 135012528 Rat 2306821 Bp335 Blood pressure QTL 335 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 106571501 135012528 Rat 631663 Bw6 Body weight QTL 6 3.4 body mass (VT:0001259) body weight (CMO:0000012) 7 111075573 134976056 Rat 1331731 Bp216 Blood pressure QTL 216 2.851 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 102297359 133492884 Rat 1558655 Swd4 Spike wave discharge measurement QTL 4 3.68 0.0002 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge severity grade (CMO:0001988) 7 86983365 131983365 Rat 731174 Uae23 Urinary albumin excretion QTL 23 2.4 0.0042 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 7 104603555 135012528 Rat 1357339 Stl14 Serum triglyceride level QTL 14 3.45 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 112729683 133492707 Rat 1331748 Bp215 Blood pressure QTL 215 4.043 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 112308254 133492884 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 2299163 Iddm34 Insulin dependent diabetes mellitus QTL 34 2.71 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 7 91281130 135012528 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 1549899 Stresp8 Stress response QTL 8 4.37 0.0008 stress-related behavior trait (VT:0010451) defensive burying duration (CMO:0001961) 7 90482196 135012528 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
RH127433
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 130,851,238 - 130,851,449 (+) MAPPER mRatBN7.2 Rnor_6.0 7 141,377,640 - 141,377,850 NCBI Rnor6.0 Rnor_5.0 X 115,882,288 - 115,882,498 UniSTS Rnor5.0 RGSC_v3.4 7 138,465,975 - 138,466,185 UniSTS RGSC3.4 Celera 7 127,332,635 - 127,332,845 UniSTS RH 3.4 Map 7 1078.1 UniSTS Cytogenetic Map 7 q36 UniSTS
22.MMHAP28FLH1.seq
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 130,851,090 - 130,851,283 (+) MAPPER mRatBN7.2 Rnor_6.0 7 141,377,492 - 141,377,684 NCBI Rnor6.0 Rnor_5.0 X 115,882,140 - 115,882,332 UniSTS Rnor5.0 RGSC_v3.4 7 138,465,827 - 138,466,019 UniSTS RGSC3.4 Celera 7 127,332,487 - 127,332,679 UniSTS Cytogenetic Map 7 q36 UniSTS
BF399697
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 130,847,422 - 130,847,666 (+) MAPPER mRatBN7.2 Rnor_6.0 7 141,373,825 - 141,374,068 NCBI Rnor6.0 Rnor_5.0 X 115,878,473 - 115,878,716 UniSTS Rnor5.0 RGSC_v3.4 7 138,462,160 - 138,462,403 UniSTS RGSC3.4 Celera 7 127,328,820 - 127,329,063 UniSTS RH 3.4 Map 7 1051.11 UniSTS Cytogenetic Map 7 q36 UniSTS
Gpd1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 130,850,541 - 130,851,498 (+) MAPPER mRatBN7.2 Rnor_6.0 7 141,376,943 - 141,377,899 NCBI Rnor6.0 Rnor_5.0 X 115,881,591 - 115,882,547 UniSTS Rnor5.0 RGSC_v3.4 7 138,465,278 - 138,466,234 UniSTS RGSC3.4 Celera 7 127,331,938 - 127,332,894 UniSTS Cytogenetic Map 7 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000087662 ⟹ ENSRNOP00000074647
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 130,844,138 - 130,851,525 (+) Ensembl Rnor_6.0 Ensembl 7 141,370,491 - 141,377,928 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000097280 ⟹ ENSRNOP00000088513
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 130,844,138 - 130,851,529 (+) Ensembl
RefSeq Acc Id:
NM_022215 ⟹ NP_071551
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 132,722,982 - 132,730,373 (+) NCBI mRatBN7.2 7 130,844,138 - 130,851,530 (+) NCBI Rnor_6.0 7 141,370,540 - 141,377,931 (+) NCBI Rnor_5.0 X 115,874,138 - 115,882,579 (+) NCBI RGSC_v3.4 7 138,458,875 - 138,466,266 (+) RGD Celera 7 127,325,535 - 127,332,926 (+) RGD
Sequence:
AGAAGCAGCACCATGGCTGGCAAGAAAGTCTGCATCGTAGGCTCCGGCAACTGGGGCTCAGCCATTGCCAAGATCGTGGGTAGTAATGCCAGCCAACTGGCACACTTTGATCCACGGGTGACCATGTG
hide sequence
RefSeq Acc Id:
NP_071551 ⟸ NM_022215
- UniProtKB:
Q5I0F4 (UniProtKB/Swiss-Prot), O35077 (UniProtKB/Swiss-Prot), A6KCH1 (UniProtKB/TrEMBL), A0A8I6AA38 (UniProtKB/TrEMBL)
- Sequence:
MAGKKVCIVGSGNWGSAIAKIVGSNASQLAHFDPRVTMWVFEEDIGGRKLTEIINTQHENVKYLPGHKLPPNVVAVPDVVQAATGADILVFVVPHQFIGKICDQLKGHLKANTIGISLIKGIDEGPNG
hide sequence
Ensembl Acc Id:
ENSRNOP00000074647 ⟸ ENSRNOT00000087662
Ensembl Acc Id:
ENSRNOP00000088513 ⟸ ENSRNOT00000097280
RGD ID: 13695651 Promoter ID: EPDNEW_R6174 Type: multiple initiation site Name: Gpd1_1 Description: glycerol-3-phosphate dehydrogenase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 141,370,531 - 141,370,591 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-11-12
Gpd1
glycerol-3-phosphate dehydrogenase 1
Gpd1
glycerol-3-phosphate dehydrogenase 1 (soluble)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Gpd1
glycerol-3-phosphate dehydrogenase 1 (soluble)
Gpd3
glycerol 3-phosphate dehydrogenase
Symbol and Name updated
1299863 APPROVED
2002-08-07
Gpd3
glycerol 3-phosphate dehydrogenase
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_transcript
contains a cAMP-response element (CRE) site at -57 that was active in the testis
704468
