Advanced Search (OLGA)

Gene: Fap (fibroblast activation protein, alpha) Rattus norvegicus

Analyze

Symbol:

Fap

Name:

fibroblast activation protein, alpha

RGD ID:

621253

Description:

Predicted to enable several functions, including integrin binding activity; peptidase activity; and protein homodimerization activity. Predicted to be involved in several processes, including melanocyte apoptotic process; melanocyte proliferation; and negative regulation of cell proliferation involved in contact inhibition. Predicted to be located in several cellular components, including basal part of cell; cell surface; and lamellipodium. Predicted to be part of peptidase complex. Predicted to be active in plasma membrane. Orthologous to human FAP (fibroblast activation protein alpha); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 3,4-methylenedioxymethamphetamine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

fibroblast activation protein; prolyl endopeptidase FAP; seprase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FAP (fibroblast activation protein alpha)	HGNC	Ensembl, HomoloGene, NCBI, OrthoMCL, Treefam
Mus musculus (house mouse):	Fap (fibroblast activation protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Fap (fibroblast activation protein alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FAP (fibroblast activation protein alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FAP (fibroblast activation protein alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Fap (fibroblast activation protein alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FAP (fibroblast activation protein alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FAP (fibroblast activation protein alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Fap (fibroblast activation protein alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Fap (fibroblast activation protein alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	FAP (fibroblast activation protein alpha)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Fap (fibroblast activation protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fap (fibroblast activation protein, alpha)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	dpp4 (dipeptidyl-peptidase 4)	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	STE13	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	dpf-2	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	dpf-2	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG17684	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|OrthoInspector)
Drosophila melanogaster (fruit fly):	CG17684	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	CG45002	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	ome	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	ome	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	fap	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	67,547,398 - 67,616,271 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	67,546,921 - 67,617,601 (-)	Ensembl				GRCr8
mRatBN7.2	3	47,138,823 - 47,207,671 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	47,138,813 - 47,225,545 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	50,493,843 - 50,562,306 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	59,077,377 - 59,145,833 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	56,850,389 - 56,919,037 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	48,467,781 - 48,536,242 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	48,467,781 - 48,536,235 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	55,133,418 - 55,201,844 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	44,457,151 - 44,525,602 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	46,780,390 - 46,848,693 (-)	NCBI		Celera
RGSC_v3.1	3	44,353,522 - 44,421,639 (-)	NCBI
Cytogenetic Map	3	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

esophagus squamous cell carcinoma (ISO)

lung non-small cell carcinoma (ISO)

lung squamous cell carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-amphetamine (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2-butoxyethanol (ISO)

2-palmitoylglycerol (ISO)

3,4-methylenedioxymethamphetamine (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP,ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

Butylbenzyl phthalate (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

DDT (EXP)

dexamethasone (ISO)

diarsenic trioxide (ISO)

diiodine (ISO)

diuron (EXP)

doxorubicin (ISO)

folic acid (ISO)

fulvestrant (ISO)

furan (EXP)

indometacin (ISO)

lipopolysaccharide (ISO)

mono(2-ethylhexyl) phthalate (ISO)

permethrin (ISO)

potassium chromate (ISO)

raloxifene (ISO)

roflumilast (ISO)

rotenone (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

tamoxifen (ISO)

triptonide (ISO)

ursolic acid (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

endothelial cell migration (IEA,ISO)

melanocyte apoptotic process (IEA,ISO)

melanocyte proliferation (IEA,ISO)

negative regulation of cell proliferation involved in contact inhibition (IEA,ISO)

negative regulation of extracellular matrix disassembly (IEA,ISO)

negative regulation of extracellular matrix organization (IEA,ISO)

positive regulation of execution phase of apoptosis (IEA,ISO)

proteolysis (IBA,IEA,ISO)

proteolysis involved in protein catabolic process (IEA,ISO)

regulation of cell cycle (IEA,ISO)

regulation of collagen catabolic process (IEA,ISO)

Cellular Component

apical part of cell (IEA,ISO)

basal part of cell (IEA,ISO)

cell projection (IEA)

cell surface (IEA,ISO)

extracellular space (IEA,ISO)

lamellipodium (IEA,ISO)

lamellipodium membrane (IEA)

peptidase complex (IEA,ISO)

plasma membrane (IBA,IEA,ISO)

Molecular Function

dipeptidyl-peptidase activity (IBA,IEA,ISO)

endopeptidase activity (IEA,ISO)

hydrolase activity (IEA)

identical protein binding (IEA,ISO)

integrin binding (IEA,ISO)

peptidase activity (IEA,ISO)

protease binding (IEA,ISO)

protein binding (ISO)

protein homodimerization activity (IEA,ISO)

serine-type endopeptidase activity (IEA,ISO)

serine-type peptidase activity (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Structural requirements for catalysis, expression, and dimerization in the CD26/DPIV gene family.	Ajami K, etal., Biochemistry 2003 Jan 28;42(3):694-701.
2.	Upregulated expression and activation of membrane‑associated proteases in esophageal squamous cell carcinoma.	Augoff K, etal., Oncol Rep. 2014 Jun;31(6):2820-6. doi: 10.3892/or.2014.3162. Epub 2014 Apr 29.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Cancer Associated Fibroblasts in Stage I-IIIA NSCLC: Prognostic Impact and Their Correlations with Tumor Molecular Markers.	Kilvaer TK, etal., PLoS One. 2015 Aug 7;10(8):e0134965. doi: 10.1371/journal.pone.0134965. eCollection 2015.
6.	Tissue analyses reveal a potential immune-adjuvant function of FAP-1 positive fibroblasts in non-small cell lung cancer.	Kilvaer TK, etal., PLoS One. 2018 Feb 7;13(2):e0192157. doi: 10.1371/journal.pone.0192157. eCollection 2018.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:9065413	PMID:9688278	PMID:10455171	PMID:10593948	PMID:12477932	PMID:15133496	PMID:16651416	PMID:17317851	PMID:19219682	PMID:21423176	PMID:24038871	PMID:26319660

Genomics

Comparative Map Data

Fap
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	67,547,398 - 67,616,271 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	67,546,921 - 67,617,601 (-)	Ensembl				GRCr8
mRatBN7.2	3	47,138,823 - 47,207,671 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	47,138,813 - 47,225,545 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	50,493,843 - 50,562,306 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	59,077,377 - 59,145,833 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	56,850,389 - 56,919,037 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	48,467,781 - 48,536,242 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	48,467,781 - 48,536,235 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	55,133,418 - 55,201,844 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	44,457,151 - 44,525,602 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	46,780,390 - 46,848,693 (-)	NCBI		Celera
RGSC_v3.1	3	44,353,522 - 44,421,639 (-)	NCBI
Cytogenetic Map	3	q21	NCBI

FAP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	162,170,684 - 162,243,445 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	162,170,684 - 162,245,151 (-)	Ensembl			hg38	GRCh38
GRCh37	2	163,027,194 - 163,099,955 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	162,735,446 - 162,808,291 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	2	162,852,708 - 162,925,552	NCBI
Celera	2	156,637,516 - 156,710,361 (-)	NCBI		Celera
Cytogenetic Map	2	q24.2	NCBI
HuRef	2	154,909,562 - 154,982,406 (-)	NCBI		HuRef
CHM1_1	2	163,033,090 - 163,105,931 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	162,627,338 - 162,700,099 (-)	NCBI		T2T-CHM13v2.0

Fap
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	62,331,280 - 62,404,365 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	62,331,287 - 62,404,419 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	62,500,936 - 62,575,509 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	62,500,943 - 62,574,075 (-)	Ensembl			mm10	GRCm38
MGSCv37	2	62,339,002 - 62,412,078 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	62,301,784 - 62,374,860 (-)	NCBI		MGSCv36	mm8
Celera	2	64,191,101 - 64,264,176 (-)	NCBI		Celera
Cytogenetic Map	2	C1.3	NCBI
cM Map	2	35.85	NCBI

Fap
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955449	11,623,741 - 11,694,335 (+)	Ensembl
ChiLan1.0	NW_004955449	11,623,838 - 11,694,256 (+)	NCBI	ChiLan1.0	ChiLan1.0

FAP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	64,862,801 - 64,937,455 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	64,877,776 - 64,951,037 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	49,464,199 - 49,537,284 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	166,832,669 - 166,905,515 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	166,832,963 - 166,904,950 (-)	Ensembl			panPan2	panpan1.1

FAP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	36	7,574,364 - 7,647,448 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	36	7,575,161 - 7,647,226 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	36	7,718,907 - 7,791,280 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	36	7,706,897 - 7,779,228 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	36	7,706,899 - 7,778,929 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	36	7,725,598 - 7,797,918 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	36	7,766,525 - 7,838,827 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	36	7,874,009 - 7,946,310 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Fap
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	124,728,654 - 124,802,072 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936469	16,817,232 - 16,888,773 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936469	16,817,000 - 16,889,066 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FAP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	68,830,730 - 68,902,379 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	15	68,831,281 - 68,902,416 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	76,323,040 - 76,394,182 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FAP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	47,578,164 - 47,652,179 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	47,577,888 - 47,652,689 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666040	151,875,647 - 151,947,663 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fap
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624732	3,275,025 - 3,345,977 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624732	3,273,339 - 3,346,207 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Fap
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	5	40,086,998 - 40,144,975 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Fap
824 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	191
Count of miRNA genes:	137
Interacting mature miRNAs:	167
Transcripts:	ENSRNOT00000008148
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10401810	Kidm53	Kidney mass QTL 53			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	28625339	67641995	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	35403199	97383526	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	58601291	153936591	Rat
631832	Sach1	Saccharin preference QTL 1	2.7	0.02	consumption behavior trait (VT:0002069)	calculated saccharin drink intake volume (CMO:0001600)	3	47904172	92904172	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	49872657	138829559	Rat
9590286	Uminl1	Urine mineral level QTL 1	3.5	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	3	48657744	93657744	Rat
10450816	Scl75	Serum cholesterol level QTL 75	4.4	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	58601291	71157804	Rat
4889966	Bss95	Bone structure and strength QTL 95	4.4		tibia area (VT:1000281)	tibia-fibula cross-sectional area (CMO:0001718)	3	37796919	82796919	Rat
2313093	Bmd77	Bone mineral density QTL 77	2.2	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	3	47904172	70710963	Rat
12879852	Cm93	Cardiac mass QTL 93		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	38708931	67641995	Rat
12879853	Am5	Aortic mass QTL 5		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	38708931	67641995	Rat
12879854	Kidm63	Kidney mass QTL 63		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	38708931	67641995	Rat
61356	Bp37	Blood pressure QTL 37	3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	51092561	96092561	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	36721849	110333156	Rat
12879849	Bw180	Body weight QTL 180		0.037	body mass (VT:0001259)	body weight (CMO:0000012)	3	38708931	67641995	Rat
12879850	Cm91	Cardiac mass QTL 91		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	38708931	67641995	Rat
2313101	Bmd76	Bone mineral density QTL 76	3.6	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	3	47904172	70710963	Rat
12879851	Cm92	Cardiac mass QTL 92		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	38708931	67641995	Rat
731172	Bp151	Blood pressure QTL 151		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	38708931	67641995	Rat
8694196	Abfw2	Abdominal fat weight QTL 2	16.58	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	48657744	93657744	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	1	141509147	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	36101403	81101403	Rat
10450852	Stl33	Serum triglyceride level QTL 33	3.4	0.05	blood LDL triglyceride amount (VT:0010699)	blood lipoprotein triglyceride level (CMO:0002685)	3	58601291	71157804	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	5675975	141509147	Rat
4889975	Bmd81	Bone mineral density QTL 81	4.3		tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	3	59119402	70710963	Rat
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	51490129	111359995	Rat
634317	Bw117	Body weight QTL 117	3.58		abdominal fat pad mass (VT:1000711)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	59863663	73704481	Rat
1331795	Rf30	Renal function QTL 30	3.708		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	3	59863663	87321459	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	51581665	184004958	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	53651826	98651826	Rat
2303593	Gluco46	Glucose level QTL 46	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	48876619	93876619	Rat
1354590	Despr11	Despair related QTL 11		0.000031	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	3	48876619	93876619	Rat
2313079	Bss73	Bone structure and strength QTL 73	1.5		tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	3	47904172	70710963	Rat
1331777	Bw24	Body weight QTL 24	3.503		body mass (VT:0001259)	body weight (CMO:0000012)	3	59863663	87321459	Rat
631647	Bp122	Blood pressure QTL 122	6.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	51092561	96092561	Rat
2313076	Bss74	Bone structure and strength QTL 74	2	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	3	47904172	70710963	Rat
1300169	Bp177	Blood pressure QTL 177	2.96		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	3	36425116	81425116	Rat
10450813	Scl74	Serum cholesterol level QTL 74	5.8	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	58601291	71157804	Rat
2302276	Bw82	Body weight QTL 82	4.32		body mass (VT:0001259)	body weight (CMO:0000012)	3	59863663	83358329	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	58925062	103925062	Rat
9590136	Scort3	Serum corticosterone level QTL 3	23.37	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	48657744	93657744	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	50766145	95766145	Rat
1558650	Cm48	Cardiac mass QTL 48	4	0.0001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	3	50766145	95766145	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	42158111	124558371	Rat
2325840	Bp345	Blood pressure QTL 345		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	38708931	83708931	Rat
8552950	Pigfal12	Plasma insulin-like growth factor 1 level QTL 12	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	48657744	93657744	Rat
631676	Cm8	Cardiac mass QTL 8	7.03	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	3	37363734	82363734	Rat
8694386	Bw159	Body weight QTL 159	4.52	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	3	48657744	93657744	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	42158111	124558371	Rat
2313049	Bss72	Bone structure and strength QTL 72	2.6	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	3	47904172	70710963	Rat

Markers in Region

RH143611

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	47,138,850 - 47,138,974 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	48,467,569 - 48,467,692	NCBI	Rnor6.0
Rnor_5.0	3	55,133,206 - 55,133,329	UniSTS	Rnor5.0
RGSC_v3.4	3	44,456,939 - 44,457,062	UniSTS	RGSC3.4
Celera	3	46,780,178 - 46,780,301	UniSTS
RH 3.4 Map	3	605.0	UniSTS
Cytogenetic Map	3	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	59	157	83	82	51	58	51	6	289	150	11	136	64	92	31	13	13

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_138850	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104225	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104226	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF493782	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC061713	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000008148 ⟹ ENSRNOP00000008148

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	67,547,383 - 67,616,353 (-)	Ensembl
mRatBN7.2 Ensembl	3	47,138,813 - 47,225,545 (-)	Ensembl
Rnor_6.0 Ensembl	3	48,467,781 - 48,535,909 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000083536 ⟹ ENSRNOP00000070543

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	47,177,592 - 47,207,193 (-)	Ensembl
Rnor_6.0 Ensembl	3	48,503,525 - 48,536,235 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096836 ⟹ ENSRNOP00000091534

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	67,546,921 - 67,617,601 (-)	Ensembl
mRatBN7.2 Ensembl	3	47,138,813 - 47,207,193 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104439 ⟹ ENSRNOP00000078725

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	67,546,921 - 67,617,601 (-)	Ensembl
mRatBN7.2 Ensembl	3	47,138,813 - 47,225,545 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000106269 ⟹ ENSRNOP00000082041

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	67,546,921 - 67,617,601 (-)	Ensembl
mRatBN7.2 Ensembl	3	47,138,813 - 47,225,545 (-)	Ensembl

RefSeq Acc Id:

NM_138850 ⟹ NP_620205

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	67,547,638 - 67,616,091 (-)	NCBI
mRatBN7.2	3	47,139,063 - 47,207,526 (-)	NCBI
Rnor_6.0	3	48,467,781 - 48,536,242 (-)	NCBI
Rnor_5.0	3	55,133,418 - 55,201,844 (-)	NCBI
RGSC_v3.4	3	44,457,151 - 44,525,602 (-)	RGD
Celera	3	46,780,390 - 46,848,693 (-)	RGD

Sequence:

show sequence

TGGAAAAATGAAGACATGGCTGAAAACCGTCTTTGGAGTCACTACTTTGGTTGCGCTTGCTCTA
GTGGTGATATGCATTGTCTTACGTCCCTCAAGAGTTTACAGCCCTGAAGGCAACACAGGAAGAT
CTCTTACCCTGAAGGATATTTTAAATGGAACATTCTCCTATAAAACATATTTTCCAAACTGGAT
TTCAGAGCAAGAATATCTTCATCAATCTGAGGATGATAACATAGTCTTTTATAATATTGAAACA
AGAGAATCCTATATCATTTTGAGTAATAGCACCATGAAAAGTGTGAATGCTACAGACTATGGCC
TGTCACCTGATCGGCAGTTTATATATCTTGAAAGTGATTATTCAAAGCTCTGGCGATATTCATA
CACAGCGACATACTACATCTACGACCTTCAGAATGGGGAATTTGTAAGAGGATACGAGCTCCCT
CGTCCAATTCAGTATCTGTGCTGGTCTCCCGTTGGGAGTAAATTAGCATATGTCTATCAAAACA
ATATTTATTTAAAACAAAGACCAGGAGATCCACCTTTTCAAATAACTTACACTGGAAGAGAAAA
TAGAATATTTAATGGAATTCCAGACTGGGTTTATGAAGAGGAAATGCTTGCTACAAAATATGCC
CTTTGGTGGTCCCCAGATGGAAAATATTTGGCATATGTAGAATTTAATGATTCGGACATACCAA
TTATTGCCTACTCGTATTATGGCGATGGACAGTATCCTAGAACTATAAATATTCCATACCCGAA
GGCCGGAGCTAAGAATCCCATTGTTCGTGTCTTTATTGTTGACACTATCTACCCACACCATGTG
GGTCCTATAGAAGTACCAGTTCCAGAGATGATAGCCTCGAGTGACTACTATTTCACCTGGCTCA
CATGGGTGACCAACGAACGAGTATGTTTGCAGTGGCTAAAGAGAGTGCAGAATGTCTCAGTCTT
GTCTATATGTGATTTCAGAGAAGACTGGCATGCGTGGGATTGTCCAAAGAACCAGGAGCATATT
GAAGAAAGCAGAACAGGATGGGCTGGTGGATTCTTTGTTTCCACACCAGCTTTTAGCCAGGATG
CCGCTTCATACTACAAAATATTTAGCGACAAGGATGGTTACAAACATATTCACTACATCAAAGA
CACTGTGGAAAATGCTATTCAAATTACAAGTGGCAAGTGGGAGGCCATATATATATTCCGAGTA
ACACAGGATTCACTGTTTTATTCTAGCAATGAATTTGAAGGTTACCCTGGAAGAAGAAACATCT
ACAGAATTAGCATTGGAAACTCTCCTCCGAGTAAGAAGTGTGTTACTTGCCATCTAAGGAAAGA
AAGGTGCCAATATTACACAGCAAGTTTCAGCTACAAAGCCAAATACTATGCACTCATCTGCTAC
GGCCCTGGCCTCCCGATTTCCACCCTCCATGATGGCCGCACAGACCAAGAAATACAAGTATTAG
AAGAGAACAAAGAACTGGAGAACGCTCTGAGAAACATCCAGCTGCCTGCAGTGGAAATTAAGAA
GCTTGAAGACGGTGGAATGACTTTCTGGTACAAGATGATTCTTCCTCCTCAGTTTGACAGATCA
AAGAAGTACCCTCTGCTAATTCAAGTGTATGGTGGTCCCTGCAGCCAGAGTGTAAAGTCTGTAT
TCTCTGTTAATTGGATAACTTATCTTGCAAGTAAAGAGGGGATAGTCGTTGCCTTGGTAGATGG
CCGGGGCACTGCTTTCCAAGGTGACAAATTCCTGCATGCCGTGTATCGAAAGCTGGGTGTGTAT
GAAGTTGAGGACCAGCTCACAGCTGTCAGAAAATTCATAGAAATGGGTTTCATTGATGAAGGAA
GAATAGCCATATGGGGATGGTCCTACGGAGGTTATGTTTCATCCCTAGCCCTTGCGTCCGGAAC
TGGCCTTTTCAAATGTGGTATAGCAGTGGCTCCAGTCTCCAGCTGGGAATACTACGCCTCTATC
TACACGGAGAGATTCATGGGCCTCCCAACAAAGGATGATAATCTTGAACACTATAAAAATTCAA
CTGTGATGGCAAGAGCAGAATATTTCAGAAATGTAGACTATCTTCTCATCCACGGAACAGCAGA
TGATAATGTGCACTTTCAGAACTCAGCACAGATTGCTAAAGCTTTGGTTAACGCACAAGTGGAT
TTCCAGGCGATGTGGTACTCTGACCAGAACCATGGCATATCATCTGGGCGCTCCCAGAACCACT
TATACACTCACATGACGCACTTCCTCAAGCAATGCTTTTCTTTATCAGACTGA

hide sequence

RefSeq Acc Id:

XM_039104225 ⟹ XP_038960153

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	67,547,617 - 67,616,271 (-)	NCBI
mRatBN7.2	3	47,138,823 - 47,207,671 (-)	NCBI

RefSeq Acc Id:

XM_039104226 ⟹ XP_038960154

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	67,547,398 - 67,616,271 (-)	NCBI
mRatBN7.2	3	47,138,823 - 47,207,671 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_620205	(Get FASTA)	NCBI Sequence Viewer
	XP_038960153	(Get FASTA)	NCBI Sequence Viewer
	XP_038960154	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH61713	(Get FASTA)	NCBI Sequence Viewer
	AAM11677	(Get FASTA)	NCBI Sequence Viewer
	EDL79010	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000008148
	ENSRNOP00000008148.8
	ENSRNOP00000078725.1
	ENSRNOP00000082041.1
	ENSRNOP00000091534
	ENSRNOP00000091534.2

RefSeq Acc Id:

NP_620205 ⟸ NM_138850

- UniProtKB:

Q8R492 (UniProtKB/TrEMBL), F1LMH7 (UniProtKB/TrEMBL), A0A9K3Y732 (UniProtKB/TrEMBL), A0A8I6G286 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MKTWLKTVFGVTTLVALALVVICIVLRPSRVYSPEGNTGRSLTLKDILNGTFSYKTYFPNWISE
QEYLHQSEDDNIVFYNIETRESYIILSNSTMKSVNATDYGLSPDRQFIYLESDYSKLWRYSYTA
TYYIYDLQNGEFVRGYELPRPIQYLCWSPVGSKLAYVYQNNIYLKQRPGDPPFQITYTGRENRI
FNGIPDWVYEEEMLATKYALWWSPDGKYLAYVEFNDSDIPIIAYSYYGDGQYPRTINIPYPKAG
AKNPIVRVFIVDTIYPHHVGPIEVPVPEMIASSDYYFTWLTWVTNERVCLQWLKRVQNVSVLSI
CDFREDWHAWDCPKNQEHIEESRTGWAGGFFVSTPAFSQDAASYYKIFSDKDGYKHIHYIKDTV
ENAIQITSGKWEAIYIFRVTQDSLFYSSNEFEGYPGRRNIYRISIGNSPPSKKCVTCHLRKERC
QYYTASFSYKAKYYALICYGPGLPISTLHDGRTDQEIQVLEENKELENALRNIQLPAVEIKKLE
DGGMTFWYKMILPPQFDRSKKYPLLIQVYGGPCSQSVKSVFSVNWITYLASKEGIVVALVDGRG
TAFQGDKFLHAVYRKLGVYEVEDQLTAVRKFIEMGFIDEGRIAIWGWSYGGYVSSLALASGTGL
FKCGIAVAPVSSWEYYASIYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTADDN
VHFQNSAQIAKALVNAQVDFQAMWYSDQNHGISSGRSQNHLYTHMTHFLKQCFSLSD

hide sequence

Ensembl Acc Id:

ENSRNOP00000008148 ⟸ ENSRNOT00000008148

Ensembl Acc Id:

ENSRNOP00000070543 ⟸ ENSRNOT00000083536

RefSeq Acc Id:	XP_038960154 ⟸ XM_039104226
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6G286 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038960153 ⟸ XM_039104225
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6G286 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000078725 ⟸ ENSRNOT00000104439

Ensembl Acc Id:

ENSRNOP00000091534 ⟸ ENSRNOT00000096836

Ensembl Acc Id:

ENSRNOP00000082041 ⟸ ENSRNOT00000106269

Protein Domains

Dipeptidylpeptidase IV N-terminal Peptidase S9 prolyl oligopeptidase catalytic

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1LMH7-F1-model_v2	AlphaFold	F1LMH7	1-760	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692104

Promoter ID:

EPDNEW_R2625

Type:

initiation region

Name:

Fap_1

Description:

fibroblast activation protein, alpha

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	48,536,316 - 48,536,376	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621253	AgrOrtholog
BioCyc Gene	G2FUF-49586	BioCyc
Ensembl Genes	ENSRNOG00000005679	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000008148	ENTREZGENE
	ENSRNOT00000008148.8	UniProtKB/TrEMBL
	ENSRNOT00000096836	ENTREZGENE
	ENSRNOT00000096836.2	UniProtKB/TrEMBL
	ENSRNOT00000104439.2	UniProtKB/TrEMBL
	ENSRNOT00000106269.2	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.1820	UniProtKB/TrEMBL
	Dipeptidylpeptidase IV, N-terminal domain	UniProtKB/TrEMBL
InterPro	AB_hydrolase	UniProtKB/TrEMBL
	Pept_S9_AS	UniProtKB/TrEMBL
	Peptidase_S9	UniProtKB/TrEMBL
	Peptidase_S9B	UniProtKB/TrEMBL
	Serine_Prot_S9B/DPPIV_sf	UniProtKB/TrEMBL
KEGG Report	rno:192203	UniProtKB/TrEMBL
NCBI Gene	192203	ENTREZGENE
PANTHER	PROTEASE FAMILY S9B,C DIPEPTIDYL-PEPTIDASE IV-RELATED	UniProtKB/TrEMBL
	PTHR11731:SF136	UniProtKB/TrEMBL
Pfam	DPPIV_N	UniProtKB/TrEMBL
	Peptidase_S9	UniProtKB/TrEMBL
PhenoGen	Fap	PhenoGen
PROSITE	PRO_ENDOPEP_SER	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000005679	RatGTEx
Superfamily-SCOP	DPP6 N-terminal domain-like	UniProtKB/TrEMBL
	SSF53474	UniProtKB/TrEMBL
UniProt	A0A8I5ZX00_RAT	UniProtKB/TrEMBL
	A0A8I6AEN0_RAT	UniProtKB/TrEMBL
	A0A8I6G286	ENTREZGENE, UniProtKB/TrEMBL
	A0A9K3Y732	ENTREZGENE, UniProtKB/TrEMBL
	F1LMH7	ENTREZGENE
	Q6P7D6_RAT	UniProtKB/TrEMBL
	Q8R492	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	F1LMH7	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-25	Fap	fibroblast activation protein, alpha	Fap	fibroblast activation protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Fap	fibroblast activation protein			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Fap	fibroblast activation protein			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_protein	substrates include the glucagonlike peptides, neuropeptide Y, and the chemokines CCL3, CCL5, CCL11, CCL22, and CXCL12	708321

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message