Symbol:
Fap
Name:
fibroblast activation protein, alpha
RGD ID:
621253
Description:
Predicted to enable several functions, including integrin binding activity; peptidase activity; and protein homodimerization activity. Predicted to be involved in several processes, including melanocyte apoptotic process; melanocyte proliferation; and negative regulation of cell proliferation involved in contact inhibition. Predicted to be located in several cellular components, including basal part of cell; cell surface; and lamellipodium. Predicted to be part of peptidase complex. Predicted to be active in plasma membrane. Orthologous to human FAP (fibroblast activation protein alpha); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 3,4-methylenedioxymethamphetamine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
fibroblast activation protein; prolyl endopeptidase FAP; seprase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 67,547,398 - 67,616,271 (-) NCBI GRCr8 mRatBN7.2 3 47,138,823 - 47,207,671 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 47,138,813 - 47,225,545 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 50,493,843 - 50,562,306 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 59,077,377 - 59,145,833 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 56,850,389 - 56,919,037 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 48,467,781 - 48,536,242 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 48,467,781 - 48,536,235 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 55,133,418 - 55,201,844 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 44,457,151 - 44,525,602 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 44,353,522 - 44,421,639 (-) NCBI Celera 3 46,780,390 - 46,848,693 (-) NCBI Celera Cytogenetic Map 3 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Fap Rat (S)-amphetamine decreases expression ISO Fap (Mus musculus) 6480464 Dextroamphetamine results in decreased expression of FAP mRNA CTD PMID:12205029 Fap Rat (S)-amphetamine multiple interactions ISO Fap (Mus musculus) 6480464 SOD1 inhibits the reaction [Dextroamphetamine results in decreased expression of FAP mRNA] CTD PMID:12205029 Fap Rat 1,2-dimethylhydrazine multiple interactions ISO Fap (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of FAP mRNA] CTD PMID:22206623 Fap Rat 1,2-dimethylhydrazine decreases expression ISO Fap (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of FAP mRNA CTD PMID:22206623 Fap Rat 17alpha-ethynylestradiol multiple interactions ISO Fap (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of FAP mRNA CTD PMID:17942748 Fap Rat 17alpha-ethynylestradiol increases expression ISO Fap (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of FAP mRNA CTD PMID:17942748 Fap Rat 17beta-estradiol increases expression ISO Fap (Mus musculus) 6480464 Estradiol results in increased expression of FAP mRNA CTD PMID:19484750 Fap Rat 17beta-estradiol multiple interactions ISO FAP (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of FAP mRNA CTD PMID:30165855 Fap Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Fap (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of FAP mRNA CTD PMID:17942748 Fap Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Fap (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of FAP mRNA CTD PMID:33956508 Fap Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of FAP mRNA CTD PMID:32109520 Fap Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Fap (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of FAP mRNA CTD PMID:21570461 Fap Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Fap Rat 2-butoxyethanol decreases expression ISO Fap (Mus musculus) 6480464 n-butoxyethanol results in decreased expression of FAP mRNA CTD PMID:19812364 Fap Rat 2-palmitoylglycerol increases expression ISO FAP (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of FAP mRNA CTD PMID:37199045 Fap Rat 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of FAP mRNA CTD PMID:30071829 Fap Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO FAP (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of FAP mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of FAP mRNA CTD PMID:28628672 Fap Rat 4,4'-sulfonyldiphenol multiple interactions ISO FAP (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of FAP mRNA CTD PMID:28628672 Fap Rat 4,4'-sulfonyldiphenol increases expression ISO FAP (Homo sapiens) 6480464 bisphenol S results in increased expression of FAP protein CTD PMID:34186270 Fap Rat 4,4'-sulfonyldiphenol increases expression ISO Fap (Mus musculus) 6480464 bisphenol S results in increased expression of FAP mRNA CTD PMID:30951980 Fap Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of FAP mRNA CTD PMID:24780913 Fap Rat 6-propyl-2-thiouracil multiple interactions ISO Fap (Mus musculus) 6480464 [Propylthiouracil co-treated with Iodine deficiency] results in decreased expression of FAP mRNA CTD PMID:36706583 Fap Rat aflatoxin B1 decreases methylation ISO FAP (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of FAP gene CTD PMID:27153756 Fap Rat all-trans-retinoic acid multiple interactions ISO Fap (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of FAP mRNA CTD PMID:36189433 Fap Rat all-trans-retinoic acid increases expression ISO Fap (Mus musculus) 6480464 Tretinoin results in increased expression of FAP mRNA CTD PMID:36189433 Fap Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of FAP mRNA CTD PMID:16483693 Fap Rat arsenous acid increases expression ISO FAP (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of FAP mRNA CTD PMID:25258189 Fap Rat benzo[a]pyrene increases expression ISO Fap (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of FAP mRNA CTD PMID:27195522 Fap Rat benzo[a]pyrene increases methylation ISO FAP (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of FAP 3' UTR CTD PMID:27901495 Fap Rat benzo[a]pyrene decreases methylation ISO FAP (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of FAP 5' UTR and Benzo(a)pyrene results in decreased methylation of FAP promoter CTD PMID:27901495 Fap Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of FAP mRNA CTD PMID:25181051 Fap Rat bisphenol A increases expression ISO FAP (Homo sapiens) 6480464 bisphenol A results in increased expression of FAP protein CTD PMID:34186270 Fap Rat bisphenol A increases methylation ISO FAP (Homo sapiens) 6480464 bisphenol A results in increased methylation of FAP gene CTD PMID:31601247 Fap Rat bisphenol A increases expression ISO Fap (Mus musculus) 6480464 bisphenol A results in increased expression of FAP mRNA CTD PMID:30951980 Fap Rat bisphenol A multiple interactions ISO FAP (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of FAP gene and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of FAP mRNA CTD PMID:28628672 and PMID:31601247 Fap Rat bisphenol AF increases expression ISO FAP (Homo sapiens) 6480464 bisphenol AF results in increased expression of FAP protein CTD PMID:34186270 Fap Rat Bisphenol B increases expression ISO FAP (Homo sapiens) 6480464 bisphenol B results in increased expression of FAP protein CTD PMID:34186270 Fap Rat bisphenol F increases expression ISO Fap (Mus musculus) 6480464 bisphenol F results in increased expression of FAP mRNA CTD PMID:30951980 Fap Rat bisphenol F increases expression ISO FAP (Homo sapiens) 6480464 bisphenol F results in increased expression of FAP protein CTD PMID:34186270 Fap Rat cadmium atom multiple interactions ISO Fap (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of FAP mRNA CTD PMID:37325564 Fap Rat cadmium dichloride multiple interactions ISO Fap (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of FAP mRNA CTD PMID:37325564 Fap Rat calcitriol decreases expression ISO FAP (Homo sapiens) 6480464 Calcitriol results in decreased expression of FAP mRNA CTD PMID:26485663 Fap Rat CGP 52608 multiple interactions ISO FAP (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to FAP gene] CTD PMID:28238834 Fap Rat cisplatin multiple interactions ISO FAP (Homo sapiens) 6480464 [Cisplatin results in decreased susceptibility to Cisplatin] which results in increased expression of FAP mRNA CTD PMID:30871063 Fap Rat DDT increases methylation EXP 6480464 DDT results in increased methylation of FAP gene CTD PMID:30207508 Fap Rat dexamethasone multiple interactions ISO FAP (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of FAP mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of FAP mRNA CTD PMID:28628672 Fap Rat diarsenic trioxide increases expression ISO FAP (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of FAP mRNA CTD PMID:25258189 Fap Rat diiodine multiple interactions ISO Fap (Mus musculus) 6480464 [Propylthiouracil co-treated with Iodine deficiency] results in decreased expression of FAP mRNA CTD PMID:36706583 Fap Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of FAP mRNA CTD PMID:25152437 Fap Rat folic acid increases expression ISO Fap (Mus musculus) 6480464 Folic Acid results in increased expression of FAP mRNA CTD PMID:25629700 Fap Rat folic acid multiple interactions ISO Fap (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of FAP mRNA] CTD PMID:22206623 Fap Rat fulvestrant multiple interactions ISO FAP (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of FAP gene CTD PMID:31601247 Fap Rat furan increases expression EXP 6480464 furan results in increased expression of FAP mRNA CTD PMID:27387713 Fap Rat indometacin multiple interactions ISO FAP (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of FAP mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of FAP mRNA CTD PMID:28628672 Fap Rat lipopolysaccharide multiple interactions ISO FAP (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of FAP mRNA CTD PMID:35811015 Fap Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Fap (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of FAP mRNA CTD PMID:36189433 Fap Rat permethrin increases expression ISO FAP (Homo sapiens) 6480464 Permethrin results in increased expression of FAP mRNA CTD PMID:37047231 Fap Rat potassium chromate decreases expression ISO FAP (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of FAP mRNA CTD PMID:22714537 Fap Rat raloxifene affects expression ISO FAP (Homo sapiens) 6480464 Raloxifene Hydrochloride affects the expression of FAP mRNA CTD PMID:14699072 Fap Rat roflumilast multiple interactions ISO FAP (Homo sapiens) 6480464 Roflumilast inhibits the reaction [TGFB1 protein results in increased expression of FAP protein] CTD PMID:39197814 Fap Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO FAP (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of FAP mRNA CTD PMID:35811015 Fap Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO FAP (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of FAP mRNA CTD PMID:35811015 Fap Rat silicon dioxide increases expression ISO FAP (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of FAP mRNA CTD PMID:23806026 Fap Rat sodium arsenite increases expression ISO FAP (Homo sapiens) 6480464 sodium arsenite results in increased expression of FAP mRNA CTD PMID:22714537 Fap Rat sodium arsenite decreases expression ISO Fap (Mus musculus) 6480464 sodium arsenite results in decreased expression of FAP protein CTD PMID:29044176 Fap Rat tamoxifen affects expression ISO FAP (Homo sapiens) 6480464 Tamoxifen affects the expression of FAP mRNA CTD PMID:14699072 Fap Rat triptonide increases expression ISO Fap (Mus musculus) 6480464 triptonide results in increased expression of FAP mRNA CTD PMID:33045310 Fap Rat ursolic acid decreases expression ISO FAP (Homo sapiens) 6480464 Ursolic Acid results in decreased expression of FAP mRNA and Ursolic Acid results in decreased expression of FAP protein CTD PMID:35786050 Fap Rat valproic acid decreases methylation ISO FAP (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of FAP gene CTD PMID:29154799 Fap Rat valproic acid increases expression ISO Fap (Mus musculus) 6480464 Valproic Acid results in increased expression of FAP mRNA CTD PMID:24896083 Fap Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of FAP gene CTD PMID:31682807
(S)-amphetamine (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2-butoxyethanol (ISO) 2-palmitoylglycerol (ISO) 3,4-methylenedioxymethamphetamine (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP,ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) arsenous acid (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (ISO) calcitriol (ISO) CGP 52608 (ISO) cisplatin (ISO) DDT (EXP) dexamethasone (ISO) diarsenic trioxide (ISO) diiodine (ISO) diuron (EXP) folic acid (ISO) fulvestrant (ISO) furan (EXP) indometacin (ISO) lipopolysaccharide (ISO) mono(2-ethylhexyl) phthalate (ISO) permethrin (ISO) potassium chromate (ISO) raloxifene (ISO) roflumilast (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) silicon dioxide (ISO) sodium arsenite (ISO) tamoxifen (ISO) triptonide (ISO) ursolic acid (ISO) valproic acid (ISO) vinclozolin (EXP)
Biological Process
endothelial cell migration (IEA,ISO) melanocyte apoptotic process (IEA,ISO) melanocyte proliferation (IEA,ISO) negative regulation of cell proliferation involved in contact inhibition (IEA,ISO) negative regulation of extracellular matrix disassembly (IEA,ISO) negative regulation of extracellular matrix organization (IEA,ISO) positive regulation of execution phase of apoptosis (IEA,ISO) proteolysis (IBA,IEA,ISO) proteolysis involved in protein catabolic process (IEA,ISO) regulation of cell cycle (IEA,ISO) regulation of collagen catabolic process (IEA,ISO)
Molecular Function
dipeptidyl-peptidase activity (IBA,IEA,ISO) endopeptidase activity (IEA,ISO) hydrolase activity (IEA) identical protein binding (IEA,ISO) integrin binding (IEA,ISO) peptidase activity (IEA,ISO) protease binding (IEA,ISO) protein binding (ISO) protein homodimerization activity (IEA,ISO) serine-type endopeptidase activity (IEA,ISO) serine-type peptidase activity (IEA,ISO)
1.
Structural requirements for catalysis, expression, and dimerization in the CD26/DPIV gene family.
Ajami K, etal., Biochemistry 2003 Jan 28;42(3):694-701.
2.
Upregulated expression and activation of membrane‑associated proteases in esophageal squamous cell carcinoma.
Augoff K, etal., Oncol Rep. 2014 Jun;31(6):2820-6. doi: 10.3892/or.2014.3162. Epub 2014 Apr 29.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Cancer Associated Fibroblasts in Stage I-IIIA NSCLC: Prognostic Impact and Their Correlations with Tumor Molecular Markers.
Kilvaer TK, etal., PLoS One. 2015 Aug 7;10(8):e0134965. doi: 10.1371/journal.pone.0134965. eCollection 2015.
6.
Tissue analyses reveal a potential immune-adjuvant function of FAP-1 positive fibroblasts in non-small cell lung cancer.
Kilvaer TK, etal., PLoS One. 2018 Feb 7;13(2):e0192157. doi: 10.1371/journal.pone.0192157. eCollection 2018.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
GOA pipeline
RGD automated data pipeline
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Fap Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 67,547,398 - 67,616,271 (-) NCBI GRCr8 mRatBN7.2 3 47,138,823 - 47,207,671 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 47,138,813 - 47,225,545 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 50,493,843 - 50,562,306 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 59,077,377 - 59,145,833 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 56,850,389 - 56,919,037 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 48,467,781 - 48,536,242 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 48,467,781 - 48,536,235 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 55,133,418 - 55,201,844 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 44,457,151 - 44,525,602 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 44,353,522 - 44,421,639 (-) NCBI Celera 3 46,780,390 - 46,848,693 (-) NCBI Celera Cytogenetic Map 3 q21 NCBI
FAP Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 162,170,684 - 162,243,445 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 162,170,684 - 162,245,151 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 163,027,194 - 163,099,955 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 162,735,446 - 162,808,291 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 162,852,708 - 162,925,552 NCBI Celera 2 156,637,516 - 156,710,361 (-) NCBI Celera Cytogenetic Map 2 q24.2 NCBI HuRef 2 154,909,562 - 154,982,406 (-) NCBI HuRef CHM1_1 2 163,033,090 - 163,105,931 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 162,627,338 - 162,700,099 (-) NCBI T2T-CHM13v2.0
Fap Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 62,331,280 - 62,404,365 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 62,331,287 - 62,404,419 (-) Ensembl GRCm39 Ensembl GRCm38 2 62,500,936 - 62,575,509 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 62,500,943 - 62,574,075 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 62,339,002 - 62,412,078 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 62,301,784 - 62,374,860 (-) NCBI MGSCv36 mm8 Celera 2 64,191,101 - 64,264,176 (-) NCBI Celera Cytogenetic Map 2 C1.3 NCBI cM Map 2 35.85 NCBI
Fap Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955449 11,623,741 - 11,694,335 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955449 11,623,838 - 11,694,256 (+) NCBI ChiLan1.0 ChiLan1.0
FAP Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 64,862,801 - 64,937,455 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 64,877,776 - 64,951,037 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 49,464,199 - 49,537,284 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 166,832,669 - 166,905,515 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 166,832,963 - 166,904,950 (-) Ensembl panpan1.1 panPan2
FAP Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 36 7,574,364 - 7,647,448 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 36 7,575,161 - 7,647,226 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 36 7,718,907 - 7,791,280 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 36 7,706,897 - 7,779,228 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 36 7,706,899 - 7,778,929 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 36 7,725,598 - 7,797,918 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 36 7,766,525 - 7,838,827 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 36 7,874,009 - 7,946,310 (-) NCBI UU_Cfam_GSD_1.0
Fap Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 124,728,654 - 124,802,072 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936469 16,817,232 - 16,888,773 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936469 16,817,000 - 16,889,066 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
FAP Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 68,830,730 - 68,902,379 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 68,831,281 - 68,902,416 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 76,323,040 - 76,394,182 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
FAP Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 47,578,164 - 47,652,179 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 47,577,888 - 47,652,689 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 151,875,647 - 151,947,663 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Fap
.
Predicted Target Of
Count of predictions: 191 Count of miRNA genes: 137 Interacting mature miRNAs: 167 Transcripts: ENSRNOT00000008148 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10401810 Kidm53 Kidney mass QTL 53 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 8227194 47233430 Rat 2298542 Neuinf11 Neuroinflammation QTL 11 3.9 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 3 15005422 76927699 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 737818 Hcar12 Hepatocarcinoma resistance QTL 12 2.6 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 3 29463235 118376539 Rat 9590286 Uminl1 Urine mineral level QTL 1 3.5 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 3 28249687 73249687 Rat 10450816 Scl75 Serum cholesterol level QTL 75 4.4 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 38192233 50749747 Rat 2313093 Bmd77 Bone mineral density QTL 77 2.2 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 3 27494621 50302886 Rat 1581503 Cm58 Cardiac mass QTL 58 2.7 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 43827364 121056321 Rat 12879852 Cm93 Cardiac mass QTL 93 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 3 18311454 47233430 Rat 12879853 Am5 Aortic mass QTL 5 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 3 18311454 47233430 Rat 12879854 Kidm63 Kidney mass QTL 63 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 18311454 47233430 Rat 61356 Bp37 Blood pressure QTL 37 3 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 3 30684642 75684642 Rat 1358905 Hrtrt17 Heart rate QTL 17 5.9 0.000014 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 10861912 89878372 Rat 12879849 Bw180 Body weight QTL 180 0.037 body mass (VT:0001259) body weight (CMO:0000012) 3 18311454 47233430 Rat 70191 BpQTLcluster4 Blood pressure QTL cluster 4 3 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 3 10778704 50302886 Rat 12879850 Cm91 Cardiac mass QTL 91 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 3 18311454 47233430 Rat 2313101 Bmd76 Bone mineral density QTL 76 3.6 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 3 27494621 50302886 Rat 731172 Bp151 Blood pressure QTL 151 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 18311454 47233430 Rat 12879851 Cm92 Cardiac mass QTL 92 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 18311454 47233430 Rat 8694196 Abfw2 Abdominal fat weight QTL 2 16.58 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 3 28249687 73249687 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 2290452 Scl56 Serum cholesterol level QTL 56 2.26 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 3 1 91609953 Rat 12879868 Am6 Aortic mass QTL 6 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 3 31426403 70668733 Rat 11565451 Bw177 Body weight QTL 177 0.002 body mass (VT:0001259) body weight (CMO:0000012) 3 31426403 70668733 Rat 10450852 Stl33 Serum triglyceride level QTL 33 3.4 0.05 blood LDL triglyceride amount (VT:0010699) blood lipoprotein triglyceride level (CMO:0002685) 3 38192233 50749747 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 11565452 Kidm57 Kidney mass QTL 57 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 31426403 70668733 Rat 4889975 Bmd81 Bone mineral density QTL 81 4.3 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 3 38710365 50302886 Rat 12879866 Cm94 Cardiac mass QTL 94 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 31426403 70668733 Rat 12879867 Cm95 Cardiac mass QTL 95 0.047 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 3 31426403 70668733 Rat 1300178 Hrtrt4 Heart rate QTL 4 3.74 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 43827364 90905114 Rat 2302055 Pia30 Pristane induced arthritis QTL 30 3.5 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 3 27936919 72936919 Rat 634317 Bw117 Body weight QTL 117 3.58 abdominal fat pad mass (VT:1000711) abdominal fat pad weight to body weight ratio (CMO:0000095) 3 39454637 53296578 Rat 1331795 Rf30 Renal function QTL 30 3.708 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 3 39454637 89115240 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 1354589 Bw31 Body weight QTL 31 3.3 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 78196190 Rat 2303593 Gluco46 Glucose level QTL 46 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 28468571 73468571 Rat 1354590 Despr11 Despair related QTL 11 0.000031 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 3 28468571 73468571 Rat 2313079 Bss73 Bone structure and strength QTL 73 1.5 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 3 27494621 50302886 Rat 1331777 Bw24 Body weight QTL 24 3.503 body mass (VT:0001259) body weight (CMO:0000012) 3 39454637 89115240 Rat 631647 Bp122 Blood pressure QTL 122 6.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 30684642 75684642 Rat 2313076 Bss74 Bone structure and strength QTL 74 2 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 3 27494621 50302886 Rat 1300169 Bp177 Blood pressure QTL 177 2.96 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 3 33703347 61017857 Rat 10450813 Scl74 Serum cholesterol level QTL 74 5.8 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 38192233 50749747 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 2302276 Bw82 Body weight QTL 82 4.32 body mass (VT:0001259) body weight (CMO:0000012) 3 39454637 62951183 Rat 738019 Anxrr10 Anxiety related response QTL 10 3.9 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 3 38517803 83517803 Rat 9590136 Scort3 Serum corticosterone level QTL 3 23.37 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 28249687 73249687 Rat 10450804 Scl70 Serum cholesterol level QTL 70 4.7 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 20714090 65714090 Rat 61419 Cia11 Collagen induced arthritis QTL 11 5.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 3 30356773 98535386 Rat 1354597 Kidm13 Kidney mass QTL 13 2.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 3 41874578 104104347 Rat 8552950 Pigfal12 Plasma insulin-like growth factor 1 level QTL 12 7.3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 3 28249687 73249687 Rat 631676 Cm8 Cardiac mass QTL 8 7.03 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 3 16954708 61954708 Rat 10450794 Scl69 Serum cholesterol level QTL 69 6.3 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 20714090 65714090 Rat 8694386 Bw159 Body weight QTL 159 4.52 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 3 28249687 73249687 Rat 1354604 Bw36 Body weight QTL 36 2.9 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 104104347 Rat 2313049 Bss72 Bone structure and strength QTL 72 2.6 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 3 27494621 50302886 Rat 2301400 Cm68 Cardiac mass QTL 68 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 3 31426403 70668733 Rat
RH143611
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 47,138,850 - 47,138,974 (+) MAPPER mRatBN7.2 Rnor_6.0 3 48,467,569 - 48,467,692 NCBI Rnor6.0 Rnor_5.0 3 55,133,206 - 55,133,329 UniSTS Rnor5.0 RGSC_v3.4 3 44,456,939 - 44,457,062 UniSTS RGSC3.4 Celera 3 46,780,178 - 46,780,301 UniSTS RH 3.4 Map 3 605.0 UniSTS Cytogenetic Map 3 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
41
113
83
82
51
25
51
6
200
89
93
43
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000008148 ⟹ ENSRNOP00000008148
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 47,138,813 - 47,225,545 (-) Ensembl Rnor_6.0 Ensembl 3 48,467,781 - 48,535,909 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000083536 ⟹ ENSRNOP00000070543
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 47,177,592 - 47,207,193 (-) Ensembl Rnor_6.0 Ensembl 3 48,503,525 - 48,536,235 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000096836 ⟹ ENSRNOP00000091534
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 47,138,813 - 47,207,193 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000104439 ⟹ ENSRNOP00000078725
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 47,138,813 - 47,225,545 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000106269 ⟹ ENSRNOP00000082041
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 47,138,813 - 47,225,545 (-) Ensembl
RefSeq Acc Id:
NM_138850 ⟹ NP_620205
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 67,547,638 - 67,616,091 (-) NCBI mRatBN7.2 3 47,139,063 - 47,207,526 (-) NCBI Rnor_6.0 3 48,467,781 - 48,536,242 (-) NCBI Rnor_5.0 3 55,133,418 - 55,201,844 (-) NCBI RGSC_v3.4 3 44,457,151 - 44,525,602 (-) RGD Celera 3 46,780,390 - 46,848,693 (-) RGD
Sequence:
TGGAAAAATGAAGACATGGCTGAAAACCGTCTTTGGAGTCACTACTTTGGTTGCGCTTGCTCTAGTGGTGATATGCATTGTCTTACGTCCCTCAAGAGTTTACAGCCCTGAAGGCAACACAGGAAGAT
hide sequence
RefSeq Acc Id:
XM_039104225 ⟹ XP_038960153
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 67,547,617 - 67,616,271 (-) NCBI mRatBN7.2 3 47,138,823 - 47,207,671 (-) NCBI
RefSeq Acc Id:
XM_039104226 ⟹ XP_038960154
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 67,547,398 - 67,616,271 (-) NCBI mRatBN7.2 3 47,138,823 - 47,207,671 (-) NCBI
RefSeq Acc Id:
NP_620205 ⟸ NM_138850
- UniProtKB:
Q8R492 (UniProtKB/TrEMBL), F1LMH7 (UniProtKB/TrEMBL), A0A9K3Y732 (UniProtKB/TrEMBL), A0A8I6G286 (UniProtKB/TrEMBL)
- Sequence:
MKTWLKTVFGVTTLVALALVVICIVLRPSRVYSPEGNTGRSLTLKDILNGTFSYKTYFPNWISEQEYLHQSEDDNIVFYNIETRESYIILSNSTMKSVNATDYGLSPDRQFIYLESDYSKLWRYSYTA
hide sequence
Ensembl Acc Id:
ENSRNOP00000008148 ⟸ ENSRNOT00000008148
Ensembl Acc Id:
ENSRNOP00000070543 ⟸ ENSRNOT00000083536
RefSeq Acc Id:
XP_038960154 ⟸ XM_039104226
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6G286 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038960153 ⟸ XM_039104225
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6G286 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000078725 ⟸ ENSRNOT00000104439
Ensembl Acc Id:
ENSRNOP00000091534 ⟸ ENSRNOT00000096836
Ensembl Acc Id:
ENSRNOP00000082041 ⟸ ENSRNOT00000106269
RGD ID: 13692104 Promoter ID: EPDNEW_R2625 Type: initiation region Name: Fap_1 Description: fibroblast activation protein, alpha SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 48,536,316 - 48,536,376 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-09-25
Fap
fibroblast activation protein, alpha
Fap
fibroblast activation protein
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Fap
fibroblast activation protein
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Fap
fibroblast activation protein
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_protein
substrates include the glucagonlike peptides, neuropeptide Y, and the chemokines CCL3, CCL5, CCL11, CCL22, and CXCL12
708321
