Symbol:
Cdx2
Name:
caudal type homeo box 2
RGD ID:
621234
Description:
Enables DNA-binding transcription factor activity and double-stranded DNA binding activity. Involved in positive regulation of DNA-templated transcription and positive regulation of cell population proliferation. Located in nucleus. Orthologous to human CDX2 (caudal type homeobox 2); INTERACTS WITH 1,2-dimethylhydrazine; 2,3,7,8-tetrachlorodibenzodioxine; beta-naphthoflavone.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
homeobox protein CDX-2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CDX2 (caudal type homeobox 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Cdx2 (caudal type homeobox 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cdx2 (caudal type homeobox 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CDX2 (caudal type homeobox 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CDX2 (caudal type homeobox 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cdx2 (caudal type homeobox 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CDX2 (caudal type homeobox 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CDX2 (caudal type homeobox 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cdx2 (caudal type homeobox 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
CDX2 (caudal type homeobox 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Cdx2 (caudal type homeobox 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cdx1b (caudal type homeobox 1 b)
Alliance
DIOPT (InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
cad
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
pal-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
cdx1
Alliance
DIOPT (InParanoid|OrthoInspector|PANTHER|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 12,762,769 - 12,769,246 (+) NCBI GRCr8 mRatBN7.2 12 7,726,798 - 7,733,142 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 7,726,798 - 7,733,142 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 8,411,731 - 8,418,073 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 9,034,882 - 9,041,224 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 8,062,897 - 8,069,239 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 9,464,026 - 9,470,565 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 9,464,026 - 9,470,565 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 11,578,762 - 11,585,434 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 8,296,103 - 8,303,643 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 8,326,030 - 8,333,571 (+) NCBI Celera 12 9,464,881 - 9,471,223 (+) NCBI Celera Cytogenetic Map 12 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cdx2 Rat 1,2-dimethylhydrazine decreases expression EXP 6480464 1 more ... CTD PMID:24740923 Cdx2 Rat 1,2-dimethylhydrazine multiple interactions ISO Cdx2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CDX2 mRNA CTD PMID:22206623 Cdx2 Rat 1,2-dimethylhydrazine multiple interactions EXP 6480464 Silybin inhibits the reaction [1 more ... CTD PMID:24740923 Cdx2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cdx2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CDX2 mRNA CTD PMID:21570461 more ... Cdx2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CDX2 mRNA CTD PMID:33387578 Cdx2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO CDX2 (Homo sapiens) 6480464 [Lipopolysaccharides co-treated with Tetrachlorodibenzodioxin] results in increased expression of CDX2 mRNA more ... CTD PMID:27783115 Cdx2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO CDX2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of CDX2 mRNA CTD PMID:20106945 more ... Cdx2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CDX2 mRNA CTD PMID:20558275 Cdx2 Rat 2-palmitoylglycerol increases expression ISO CDX2 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of CDX2 mRNA CTD PMID:37199045 Cdx2 Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione multiple interactions ISO CDX2 (Homo sapiens) 6480464 bisindolylmaleimide I inhibits the reaction [puag-haad results in increased expression of CDX2 mRNA] and bisindolylmaleimide I inhibits the reaction [puag-haad results in increased expression of CDX2 protein] CTD PMID:28780155 Cdx2 Rat 3-methyladenine increases expression ISO Cdx2 (Mus musculus) 6480464 3-methyladenine results in increased expression of CDX2 mRNA CTD PMID:21681844 Cdx2 Rat 4,4'-sulfonyldiphenol decreases methylation ISO CDX2 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of CDX2 gene CTD PMID:31601247 Cdx2 Rat 5-aza-2'-deoxycytidine multiple interactions ISO CDX2 (Homo sapiens) 6480464 [Decitabine co-treated with CDX2 protein] results in increased expression of KRT20 mRNA more ... CTD PMID:16990345 and PMID:18845559 Cdx2 Rat 5-aza-2'-deoxycytidine increases expression ISO CDX2 (Homo sapiens) 6480464 Decitabine results in increased expression of CDX2 mRNA CTD PMID:16990345 and PMID:18845559 Cdx2 Rat 5-aza-2'-deoxycytidine decreases methylation ISO CDX2 (Homo sapiens) 6480464 Decitabine results in decreased methylation of CDX2 promoter CTD PMID:16990345 Cdx2 Rat 5-fluorouracil decreases expression ISO Cdx2 (Mus musculus) 6480464 Fluorouracil results in decreased expression of CDX2 protein CTD PMID:21296659 Cdx2 Rat 5-fluorouracil decreases expression ISO CDX2 (Homo sapiens) 6480464 Fluorouracil results in decreased expression of CDX2 mRNA CTD PMID:24737281 Cdx2 Rat acetic acid affects expression ISO Cdx2 (Mus musculus) 6480464 Acetic Acid affects the expression of CDX2 protein CTD PMID:21296659 Cdx2 Rat acetic acid [2-[[(5-nitro-2-thiazolyl)amino]-oxomethyl]phenyl] ester multiple interactions ISO Cdx2 (Mus musculus) 6480464 nitazoxanide inhibits the reaction [Dextran Sulfate results in decreased expression of CDX2 protein] CTD PMID:38663798 Cdx2 Rat acetic acid [2-[[(5-nitro-2-thiazolyl)amino]-oxomethyl]phenyl] ester increases expression ISO CDX2 (Homo sapiens) 6480464 nitazoxanide results in increased expression of CDX2 protein CTD PMID:38663798 Cdx2 Rat amosite asbestos decreases methylation ISO CDX2 (Homo sapiens) 6480464 Asbestos and Amosite results in decreased methylation of CDX2 promoter CTD PMID:29626692 Cdx2 Rat arsenous acid decreases expression ISO CDX2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of CDX2 mRNA CTD PMID:30748021 Cdx2 Rat benzo[a]pyrene increases methylation ISO CDX2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of CDX2 exon CTD PMID:27901495 Cdx2 Rat benzo[e]pyrene decreases methylation ISO CDX2 (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of CDX2 exon CTD PMID:30157460 Cdx2 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of CDX2 mRNA CTD PMID:18164116 Cdx2 Rat bis(2-ethylhexyl) phthalate increases expression ISO Cdx2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of CDX2 mRNA CTD PMID:28286118 Cdx2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CDX2 mRNA CTD PMID:25181051 Cdx2 Rat bisphenol A increases expression ISO Cdx2 (Mus musculus) 6480464 bisphenol A results in increased expression of CDX2 mRNA CTD PMID:34585602 Cdx2 Rat bromochloroacetic acid increases expression ISO Cdx2 (Mus musculus) 6480464 bromochloroacetic acid results in increased expression of CDX2 protein CTD PMID:21296659 Cdx2 Rat CGP 52608 multiple interactions ISO CDX2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CDX2 gene] CTD PMID:28238834 Cdx2 Rat chenodeoxycholic acid increases expression ISO CDX2 (Homo sapiens) 6480464 Chenodeoxycholic Acid results in increased expression of CDX2 mRNA CTD PMID:20818264 Cdx2 Rat choline multiple interactions ISO Cdx2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of CDX2 gene CTD PMID:20938992 Cdx2 Rat crocidolite asbestos decreases methylation ISO CDX2 (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased methylation of CDX2 promoter CTD PMID:29626692 Cdx2 Rat curcumin increases expression EXP 6480464 Curcumin results in increased expression of CDX2 mRNA CTD PMID:18299980 Cdx2 Rat curcumin increases expression ISO Cdx2 (Mus musculus) 6480464 Curcumin results in increased expression of CDX2 mRNA CTD PMID:27237783 Cdx2 Rat dextran sulfate increases expression ISO Cdx2 (Mus musculus) 6480464 Dextran Sulfate results in increased expression of CDX2 protein CTD PMID:29680209 Cdx2 Rat dextran sulfate decreases expression ISO Cdx2 (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of CDX2 protein CTD PMID:38663798 Cdx2 Rat dextran sulfate multiple interactions ISO Cdx2 (Mus musculus) 6480464 6-formylindolo(3 more ... CTD PMID:29680209 and PMID:38663798 Cdx2 Rat diarsenic trioxide decreases expression ISO CDX2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of CDX2 mRNA CTD PMID:30748021 Cdx2 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of CDX2 mRNA CTD PMID:18035473 Cdx2 Rat folic acid multiple interactions ISO Cdx2 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Cdx2 Rat furan increases expression EXP 6480464 furan results in increased expression of CDX2 mRNA CTD PMID:27387713 Cdx2 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of CDX2 mRNA CTD PMID:33387578 Cdx2 Rat GS-441524 increases expression ISO Cdx2 (Mus musculus) 6480464 GS-441524 results in increased expression of CDX2 mRNA CTD PMID:35605700 Cdx2 Rat hydrogen peroxide affects expression ISO CDX2 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of CDX2 mRNA CTD PMID:20044591 Cdx2 Rat indole-3-methanol multiple interactions ISO CDX2 (Homo sapiens) 6480464 indole-3-carbinol promotes the reaction [CL 075 results in increased expression of CDX2 mRNA] CTD PMID:27783115 Cdx2 Rat L-methionine multiple interactions ISO Cdx2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of CDX2 gene CTD PMID:20938992 Cdx2 Rat lipopolysaccharide multiple interactions ISO Cdx2 (Mus musculus) 6480464 CDX2 protein promotes the reaction [Lipopolysaccharides results in increased expression of IL6 protein] and CDX2 protein promotes the reaction [Lipopolysaccharides results in increased expression of TNF protein] CTD PMID:21131441 Cdx2 Rat lipopolysaccharide multiple interactions ISO CDX2 (Homo sapiens) 6480464 [Lipopolysaccharides co-treated with 6-formylindolo(3 more ... CTD PMID:27783115 Cdx2 Rat lipopolysaccharide increases response to substance ISO Cdx2 (Mus musculus) 6480464 CDX2 protein results in increased susceptibility to Lipopolysaccharides CTD PMID:21131441 Cdx2 Rat LY294002 multiple interactions EXP 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [CDX2 protein results in increased expression of IL1B mRNA] CTD PMID:15350541 Cdx2 Rat methapyrilene decreases methylation ISO CDX2 (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of CDX2 exon CTD PMID:30157460 Cdx2 Rat methyl methanesulfonate multiple interactions ISO CDX2 (Homo sapiens) 6480464 Methyl Methanesulfonate inhibits the reaction [decitabine results in increased expression of CDX2 mRNA] CTD PMID:16990345 Cdx2 Rat methyl methanesulfonate decreases expression ISO CDX2 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of CDX2 mRNA CTD PMID:16990345 Cdx2 Rat methylmercury chloride affects expression EXP 6480464 methylmercuric chloride affects the expression of CDX2 mRNA CTD PMID:20864626 Cdx2 Rat N-methyl-4-phenylpyridinium decreases expression ISO Cdx2 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of CDX2 mRNA CTD PMID:27037955 Cdx2 Rat N-methyl-4-phenylpyridinium affects localization ISO Cdx2 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium affects the localization of CDX2 protein CTD PMID:27037955 Cdx2 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of CDX2 mRNA CTD PMID:18164116 Cdx2 Rat nitric oxide increases chemical synthesis ISO Cdx2 (Mus musculus) 6480464 CDX2 gene mutant form results in increased chemical synthesis of Nitric Oxide CTD PMID:29439001 Cdx2 Rat Octicizer decreases expression ISO CDX2 (Homo sapiens) 6480464 2-ethylhexyldiphenylphosphate results in decreased expression of CDX2 protein CTD PMID:37027338 Cdx2 Rat Octicizer decreases expression ISO Cdx2 (Mus musculus) 6480464 2-ethylhexyldiphenylphosphate results in decreased expression of CDX2 protein CTD PMID:35503735 Cdx2 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of CDX2 mRNA CTD PMID:33387578 Cdx2 Rat perfluorooctane-1-sulfonic acid decreases expression EXP 6480464 perfluorooctane sulfonic acid results in decreased expression of CDX2 mRNA CTD PMID:18692542 Cdx2 Rat phenytoin increases expression EXP 6480464 Phenytoin results in increased expression of CDX2 mRNA CTD PMID:20345932 Cdx2 Rat poly(I:C) multiple interactions ISO CDX2 (Homo sapiens) 6480464 [Poly I-C co-treated with 6-formylindolo(3 more ... CTD PMID:27783115 Cdx2 Rat remdesivir increases expression ISO Cdx2 (Mus musculus) 6480464 remdesivir results in increased expression of CDX2 mRNA CTD PMID:35605700 Cdx2 Rat retinyl acetate increases expression ISO Cdx2 (Mus musculus) 6480464 retinol acetate results in increased expression of CDX2 mRNA CTD PMID:16772331 Cdx2 Rat SB 431542 affects expression ISO CDX2 (Homo sapiens) 6480464 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide affects the expression of CDX2 mRNA CTD PMID:25670856 Cdx2 Rat serpentine asbestos decreases methylation ISO CDX2 (Homo sapiens) 6480464 Asbestos and Serpentine results in decreased methylation of CDX2 promoter CTD PMID:29626692 Cdx2 Rat silibinin multiple interactions EXP 6480464 Silybin inhibits the reaction [1 more ... CTD PMID:24740923 Cdx2 Rat sirolimus increases expression ISO Cdx2 (Mus musculus) 6480464 Sirolimus results in increased expression of CDX2 mRNA CTD PMID:21681844 Cdx2 Rat Theaflavin 3,3'-digallate affects expression ISO CDX2 (Homo sapiens) 6480464 theaflavin-3 and 3'-digallate affects the expression of CDX2 mRNA CTD PMID:34925699 Cdx2 Rat titanium dioxide decreases methylation ISO Cdx2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of CDX2 gene CTD PMID:35295148 Cdx2 Rat titanium dioxide increases methylation ISO Cdx2 (Mus musculus) 6480464 titanium dioxide results in increased methylation of CDX2 gene CTD PMID:35295148 Cdx2 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of CDX2 mRNA CTD PMID:33387578 Cdx2 Rat trichostatin A multiple interactions ISO CDX2 (Homo sapiens) 6480464 trichostatin A promotes the reaction [decitabine results in increased expression of CDX2 mRNA] CTD PMID:16990345 Cdx2 Rat valproic acid increases methylation ISO CDX2 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of CDX2 gene CTD PMID:29154799 Cdx2 Rat valproic acid increases expression ISO Cdx2 (Mus musculus) 6480464 Valproic Acid results in increased expression of CDX2 mRNA CTD PMID:27237783 and PMID:27693483
1,2-dimethylhydrazine (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-palmitoylglycerol (ISO) 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (ISO) 3-methyladenine (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) acetic acid (ISO) acetic acid [2-[[(5-nitro-2-thiazolyl)amino]-oxomethyl]phenyl] ester (ISO) amosite asbestos (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) beta-naphthoflavone (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bromochloroacetic acid (ISO) CGP 52608 (ISO) chenodeoxycholic acid (ISO) choline (ISO) crocidolite asbestos (ISO) curcumin (EXP,ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) flavonoids (EXP) folic acid (ISO) furan (EXP) gentamycin (EXP) GS-441524 (ISO) hydrogen peroxide (ISO) indole-3-methanol (ISO) L-methionine (ISO) lipopolysaccharide (ISO) LY294002 (EXP) methapyrilene (ISO) methyl methanesulfonate (ISO) methylmercury chloride (EXP) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP) nitric oxide (ISO) Octicizer (ISO) paracetamol (EXP) perfluorooctane-1-sulfonic acid (EXP) phenytoin (EXP) poly(I:C) (ISO) remdesivir (ISO) retinyl acetate (ISO) SB 431542 (ISO) serpentine asbestos (ISO) silibinin (EXP) sirolimus (ISO) Theaflavin 3,3'-digallate (ISO) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) valproic acid (ISO)
Biological Process
anterior/posterior axis specification (IBA) anterior/posterior pattern specification (IEA,ISO) blastocyst development (IEA,ISO) blood vessel development (IEA,ISO) cell differentiation (IBA) digestive tract development (IBA) embryonic pattern specification (IBA) endosome to lysosome transport (IEA,ISO) establishment or maintenance of epithelial cell apical/basal polarity (IEA,ISO) intestinal epithelial cell differentiation (IEA,ISO) labyrinthine layer development (IEA,ISO) negative regulation of transcription by RNA polymerase II (IEA,ISO) pattern specification process (IEA,ISO) placenta development (IEA,ISO) positive regulation of cell differentiation (IEA,ISO) positive regulation of cell population proliferation (IDA) positive regulation of DNA-templated transcription (IDA) positive regulation of transcription by RNA polymerase II (IEA,ISO) regulation of DNA-templated transcription (IEA) regulation of somitogenesis (IEA,ISO) regulation of transcription by RNA polymerase II (IBA,IEA,ISO) somatic stem cell population maintenance (IEA,ISO) stem cell differentiation (IEA,ISO) trophectodermal cell differentiation (IEA,ISO)
Molecular Function
DNA binding (IEA) DNA-binding transcription factor activity (IBA,IDA,IEA,ISO) DNA-binding transcription factor activity, RNA polymerase II-specific (IEA) DNA-binding transcription repressor activity, RNA polymerase II-specific (IEA,ISO) double-stranded DNA binding (IDA) methyl-CpG binding (IEA,ISO) protein binding (ISO) RNA polymerase II cis-regulatory region sequence-specific DNA binding (IEA,ISO) RNA polymerase II transcription regulatory region sequence-specific DNA binding (IBA) sequence-specific DNA binding (IEA,ISO) sequence-specific double-stranded DNA binding (IEA,ISO)
1.
Homeosis and intestinal tumours in Cdx2 mutant mice.
Chawengsaksophak K, etal., Nature 1997 Mar 6;386(6620):84-7.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
AGR2 gene function requires a unique endoplasmic reticulum localization motif.
Gupta A, etal., J Biol Chem. 2012 Feb 10;287(7):4773-82. doi: 10.1074/jbc.M111.301531. Epub 2011 Dec 19.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
GOA pipeline
RGD automated data pipeline
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
CDX2, COX2 and MUC2 expressions in Barrett's esophagus: can they be useful in determination of the dysplasia?
Turkmen IC, etal., Turk Patoloji Derg. 2012;28(3):251-8. doi: 10.5146/tjpath.2012.01132.
10.
Heparin-binding EGF-like growth factor gene transcription regulated by Cdx2 in the intestinal epithelium.
Uesaka T, etal., Am J Physiol Gastrointest Liver Physiol 2002 Oct;283(4):G840-7.
Cdx2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 12,762,769 - 12,769,246 (+) NCBI GRCr8 mRatBN7.2 12 7,726,798 - 7,733,142 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 7,726,798 - 7,733,142 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 8,411,731 - 8,418,073 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 9,034,882 - 9,041,224 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 8,062,897 - 8,069,239 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 9,464,026 - 9,470,565 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 9,464,026 - 9,470,565 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 11,578,762 - 11,585,434 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 8,296,103 - 8,303,643 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 8,326,030 - 8,333,571 (+) NCBI Celera 12 9,464,881 - 9,471,223 (+) NCBI Celera Cytogenetic Map 12 p11 NCBI
CDX2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 13 27,960,918 - 27,969,315 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 13 27,960,918 - 27,969,315 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 13 28,535,055 - 28,543,452 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 13 27,434,278 - 27,441,317 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 13 27,434,278 - 27,441,317 NCBI Celera 13 9,611,324 - 9,618,360 (-) NCBI Celera Cytogenetic Map 13 q12.2 NCBI HuRef 13 9,356,889 - 9,364,186 (-) NCBI HuRef CHM1_1 13 28,504,663 - 28,511,974 (-) NCBI CHM1_1 T2T-CHM13v2.0 13 27,182,310 - 27,190,703 (-) NCBI T2T-CHM13v2.0
Cdx2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 147,237,710 - 147,244,059 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 147,237,615 - 147,244,080 (-) Ensembl GRCm39 Ensembl GRCm38 5 147,300,900 - 147,307,249 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 147,300,805 - 147,307,270 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 148,112,476 - 148,118,825 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 147,611,249 - 147,617,598 (-) NCBI MGSCv36 mm8 Celera 5 145,292,162 - 145,298,512 (-) NCBI Celera Cytogenetic Map 5 G3 NCBI cM Map 5 86.86 NCBI
Cdx2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955497 7,316,372 - 7,321,627 (-) NCBI ChiLan1.0 ChiLan1.0
CDX2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 14 27,548,318 - 27,556,707 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 13 18,652,989 - 18,661,365 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 13 9,241,856 - 9,250,297 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 13 27,585,194 - 27,593,632 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 13 27,586,340 - 27,593,632 (-) Ensembl panpan1.1 panPan2
CDX2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 25 11,701,134 - 11,707,883 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 25 11,700,779 - 11,707,127 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 25 11,764,347 - 11,771,858 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 25 11,830,047 - 11,837,557 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 25 11,830,188 - 11,836,088 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 25 11,724,391 - 11,732,134 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 25 11,716,837 - 11,724,610 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 25 11,761,010 - 11,768,541 (+) NCBI UU_Cfam_GSD_1.0
Cdx2
CDX2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 11 5,339,716 - 5,346,057 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 11 5,339,727 - 5,346,081 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 11 5,113,685 - 5,120,021 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CDX2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 3 7,080,142 - 7,088,010 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 3 7,078,503 - 7,087,285 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666057 37,301,589 - 37,309,900 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cdx2
.
Predicted Target Of
Count of predictions: 111 Count of miRNA genes: 99 Interacting mature miRNAs: 104 Transcripts: ENSRNOT00000048188 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
2312418 Kidm41 Kidney mass QTL 41 3.7 0.0001 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 12 1 19611090 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 1581516 Cm56 Cardiac mass QTL 56 4.2 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 12 1 29333307 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 6893681 Bw109 Body weight QTL 109 2.3 0.004 body mass (VT:0001259) body weight (CMO:0000012) 12 1 23297788 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 1300174 Bw15 Body weight QTL 15 2.93 body mass (VT:0001259) body weight loss (CMO:0001399) 12 1 9318387 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat 1600391 Edcs2 Endometrial carcinoma susceptibility QTL2 3.5 0.01 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 12 6833190 17870186 Rat 10755457 Coatc14 Coat color QTL 14 0.01759 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 12 1 22591684 Rat 724526 Uae3 Urinary albumin excretion QTL 3 4.9 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 12 3906969 10373166 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 7243862 Mcs30 Mammary carcinoma susceptibility QTL 30 8.62 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 12 797729 8525593 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
5
21
44
41
24
23
24
6
84
37
10
14
27
17
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000048188 ⟹ ENSRNOP00000045045
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 7,726,798 - 7,733,142 (+) Ensembl Rnor_6.0 Ensembl 12 9,464,026 - 9,470,565 (+) Ensembl
RefSeq Acc Id:
NM_023963 ⟹ NP_076453
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 12,762,904 - 12,769,246 (+) NCBI mRatBN7.2 12 7,726,798 - 7,733,142 (+) NCBI Rnor_6.0 12 9,464,026 - 9,470,565 (+) NCBI Rnor_5.0 12 11,578,762 - 11,585,434 (+) NCBI RGSC_v3.4 12 8,296,103 - 8,303,643 (+) RGD Celera 12 9,464,881 - 9,471,223 (+) RGD
Sequence:
CAGTAATCAGCTACCTTTATCCCTAGCCCCCTGCGCCCCGCGCCCCTGGCAGCCTTCAACGCTTGTCCCCAGGCAGTATGGTGAGGTCTGCTCTGGGTCCCTCGCCACCATGTACGTGAGCTACCTTC
hide sequence
RefSeq Acc Id:
XM_063271647 ⟹ XP_063127717
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 12,762,769 - 12,769,240 (+) NCBI
RefSeq Acc Id:
NP_076453 ⟸ NM_023963
- UniProtKB:
Q9ESV7 (UniProtKB/TrEMBL), F1M7G8 (UniProtKB/TrEMBL), A0A9K3Y7D3 (UniProtKB/TrEMBL)
- Sequence:
MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPTAYGAPLREDWNGYAPGGAAAANAVAHGLNGGSPAAAMGYSSPAEYHAHHHPHHHPHHPAAA
hide sequence
Ensembl Acc Id:
ENSRNOP00000045045 ⟸ ENSRNOT00000048188
RefSeq Acc Id:
XP_063127717 ⟸ XM_063271647
- Peptide Label:
isoform X1
RGD ID: 13698402 Promoter ID: EPDNEW_R8927 Type: initiation region Name: Cdx2_1 Description: caudal type homeo box 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 12 9,463,987 - 9,464,047 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-01-20
Cdx2
caudal type homeo box 2
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Cdx2
caudal type homeo box 2
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
expression is restricted to the intestine
625733
gene_physical_interaction
interacts with DNA elements that have an AT-rich consensus sequence (TTTAC/T)
625733
gene_process
induces expression of heparin-binding EGF-like growth factor (HB-EGF)
625733
gene_process
activates transcription of heparin-binding EGF-like growth factor (HB-EGF) in intestinal epithetial cells (IEC)-6
625733
gene_process
activates several genes that are not involved in cell proliferation, including sucrase-isomaltase (SI), lactase-phlorizin hydrolase, lactase, apolipoprotein B, carbonic anhydrase 1, calbindin-D9K, and clusterin
625733
gene_process
mediates cell proliferation and migration by activation of gene transcription
625733
gene_product
member of the caudal-related homeobox gene family
625733
gene_regulation
function inhibited partially by an EGF receptor-specific tyrosine kinase inhibitor, PD-153035
625733
