Advanced Search (OLGA)

Gene: Dao (D-amino-acid oxidase) Rattus norvegicus

Analyze

Symbol:

Dao

Name:

D-amino-acid oxidase

RGD ID:

621138

Description:

Predicted to enable FAD binding activity; identical protein binding activity; and oxidoreductase activity, acting on the CH-NH2 group of donors. Predicted to be involved in several processes, including alpha-amino acid catabolic process; dopamine biosynthetic process; and neutrophil-mediated killing of gram-negative bacterium. Predicted to act upstream of or within L-leucine metabolic process. Located in peroxisomal matrix and presynaptic active zone. Human ortholog(s) of this gene implicated in schizophrenia. Orthologous to human DAO (D-amino acid oxidase); PARTICIPATES IN AGAT deficiency pathway; arginine and proline metabolic pathway; guanidinoacetate methyltransferase deficiency pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 2,2,2-tetramine; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

D-amino acid oxidase; D-amino acid oxidase 1; DAAO; DAMOX; Dao1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DAO (D-amino acid oxidase)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):	Dao (D-amino acid oxidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Dao (D-amino acid oxidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DAO (D-amino acid oxidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DAO (D-amino acid oxidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dao (D-amino acid oxidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DAO (D-amino acid oxidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DAO (D-amino acid oxidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dao (D-amino acid oxidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Dao (D-amino acid oxidase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	DAO (D-amino acid oxidase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dao.3 (D-amino-acid oxidase, tandem duplicate 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dao.1 (D-amino-acid oxidase, tandem duplicate 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dao.2 (D-amino-acid oxidase, tandem duplicate 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG11236	Alliance	DIOPT (Hieranoid\|OMA\|PANTHER)
Caenorhabditis elegans (roundworm):	daao-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG12338	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ddo-1	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER)
Caenorhabditis elegans (roundworm):	ddo-2	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER)
Caenorhabditis elegans (roundworm):	ddo-3	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	dao	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	48,252,900 - 48,275,964 (-)	NCBI		GRCr8
mRatBN7.2	12	42,592,342 - 42,613,046 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	42,592,343 - 42,612,741 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	43,758,494 - 43,778,668 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	44,372,084 - 44,392,254 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	43,432,603 - 43,452,773 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	48,353,691 - 48,373,647 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	48,354,196 - 48,365,784 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	50,135,334 - 50,157,417 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	43,627,593 - 43,648,332 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	43,490,980 - 43,511,720 (-)	NCBI
Celera	12	44,196,549 - 44,215,768 (-)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

amyotrophic lateral sclerosis (ISO)

autistic disorder (ISO)

Experimental Liver Cirrhosis (ISO)

genetic disease (ISO)

schizophrenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,2,2-tetramine (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,4-methylenedioxymethamphetamine (EXP)

3-chloropropane-1,2-diol (EXP)

4,4'-diaminodiphenylmethane (EXP)

4-hydroxyphenyl retinamide (ISO)

5-methyl-pyrazole-3-carboxylic acid (EXP)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

Ampullosporin (EXP)

benzene (EXP)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP)

cadmium acetate (EXP)

chlorpromazine (ISO)

chromium(6+) (ISO)

clofibrate (EXP,ISO)

clofibric acid (EXP)

copper atom (EXP)

copper(0) (EXP)

cyclosporin A (ISO)

diquat (ISO)

epoxomicin (ISO)

ethanol (EXP)

flutamide (EXP)

furan (EXP)

gentamycin (EXP)

glafenine (EXP)

glycidol (EXP)

indometacin (EXP)

ketamine (EXP)

L-ascorbic acid (ISO)

lead diacetate (EXP,ISO)

levetiracetam (EXP)

methapyrilene (EXP,ISO)

N-nitrosodiethylamine (EXP)

N-nitrosodimethylamine (EXP)

nefazodone (EXP)

O-methyleugenol (ISO)

paracetamol (ISO)

paraquat (ISO)

PCB138 (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (EXP)

perfluorooctanoic acid (EXP)

pirinixic acid (EXP,ISO)

Propiverine (EXP)

resveratrol (ISO)

rotenone (EXP)

sodium arsenite (ISO)

sodium azide (ISO)

sodium benzoate (EXP,ISO)

sodium dichromate (EXP)

sodium fluoride (ISO)

streptozocin (EXP)

thioacetamide (EXP)

triptonide (ISO)

valproic acid (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

D-alanine catabolic process (IBA,ISO)

D-amino acid catabolic process (ISO)

D-amino acid metabolic process (IEA)

D-serine catabolic process (IBA,ISO)

D-serine metabolic process (ISO)

digestion (ISO,ISS)

dopamine biosynthetic process (ISO,ISS)

killing by host of symbiont cells (ISO)

L-leucine metabolic process (ISO)

neutrophil-mediated killing of gram-negative bacterium (ISO,ISS)

proline catabolic process (IBA,ISO)

Cellular Component

cell projection (IEA)

cytoplasm (IBA,ISO)

cytosol (ISO)

extracellular space (ISO)

mitochondrial outer membrane (ISO)

peroxisomal matrix (IDA,ISO)

peroxisome (ISS)

presynaptic active zone (IDA)

Molecular Function

D-amino-acid dehydrogenase activity (ISO)

D-amino-acid oxidase activity (IBA,IEA,ISO)

FAD binding (IEA,ISO)

glycine oxidase activity (IEA)

identical protein binding (ISO)

protein binding (IPI,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

AGAT deficiency pathway (ISO)

arginine and proline metabolic pathway (IEA,ISO)

D-arginine and D-ornithine metabolic pathway (IEA)

glycine, serine and threonine metabolic pathway (IEA)

guanidinoacetate methyltransferase deficiency pathway (ISO)

gyrate atrophy pathway (ISO)

hyperprolinemia type I pathway (ISO)

hyperprolinemia type II pathway (ISO)

ornithine translocase deficiency pathway (ISO)

prolidase deficiency pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Heterogenous staining of D-amino acid oxidase in peroxisomes of rat liver and kidney. A light and electron microscopic study.	Angermüller S and Fahimi HD, Histochemistry. 1988;88(3-6):277-85.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Role of renal D-amino-acid oxidase in pharmacokinetics of D-leucine.	Hasegawa H, etal., Am J Physiol Endocrinol Metab 2004 Jul;287(1):E160-5. Epub 2004 Mar 16.
4.	Rat D-amino-acid oxidase cDNA: rat D-amino-acid oxidase as an intermediate form between mouse and other mammalian D-amino-acid oxidases.	Konno R Biochim Biophys Acta 1998 Jan 21;1395(2):165-70.
5.	Novel insights into renal D-amino acid oxidase accumulation: propiverine changes DAAO localization and peroxisomal size in vivo.	Luks L, etal., Arch Toxicol. 2017 Jan;91(1):427-437. doi: 10.1007/s00204-016-1685-z. Epub 2016 Mar 9.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
11.	D-amino acid oxidase activity is inhibited by an interaction with bassoon protein at the presynaptic active zone.	Popiolek M, etal., J Biol Chem. 2011 Aug 19;286(33):28867-28875. doi: 10.1074/jbc.M111.262063. Epub 2011 Jun 23.
12.	GOA pipeline	RGD automated data pipeline
13.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Examination of G72 and D-amino-acid oxidase as genetic risk factors for schizophrenia and bipolar affective disorder.	Schumacher J, etal., Mol Psychiatry 2004 Feb;9(2):203-7.

Additional References at PubMed

PMID:2572224	PMID:12364586	PMID:12477932	PMID:15489334	PMID:16616139	PMID:17303072	PMID:18544534	PMID:18716858	PMID:19309736	PMID:19685198	PMID:20178365	PMID:20368421
PMID:20521334	PMID:20603179	PMID:21110210	PMID:21679769	PMID:24005798	PMID:24138986	PMID:32512180	PMID:33319325	PMID:38044118

Genomics

Comparative Map Data

Dao
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	48,252,900 - 48,275,964 (-)	NCBI		GRCr8
mRatBN7.2	12	42,592,342 - 42,613,046 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	42,592,343 - 42,612,741 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	43,758,494 - 43,778,668 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	44,372,084 - 44,392,254 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	43,432,603 - 43,452,773 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	48,353,691 - 48,373,647 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	48,354,196 - 48,365,784 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	50,135,334 - 50,157,417 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	43,627,593 - 43,648,332 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	43,490,980 - 43,511,720 (-)	NCBI
Celera	12	44,196,549 - 44,215,768 (-)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

DAO
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	108,880,092 - 108,901,043 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	108,858,932 - 108,901,043 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	109,273,868 - 109,294,819 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	107,797,986 - 107,818,839 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	107,776,332 - 107,797,162	NCBI
Celera	12	108,942,740 - 108,963,590 (+)	NCBI		Celera
Cytogenetic Map	12	q24.11	NCBI
HuRef	12	106,338,463 - 106,359,320 (+)	NCBI		HuRef
CHM1_1	12	109,241,476 - 109,262,347 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	108,854,786 - 108,875,798 (+)	NCBI		T2T-CHM13v2.0

Dao
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	114,137,696 - 114,163,736 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	114,141,764 - 114,163,743 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	113,999,635 - 114,025,675 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	114,003,703 - 114,025,682 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	114,453,835 - 114,475,469 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	114,270,835 - 114,285,905 (+)	NCBI		MGSCv36	mm8
Celera	5	111,106,565 - 111,127,023 (+)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	55.93	NCBI

Dao
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955455	10,095,300 - 10,127,666 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955455	10,095,597 - 10,127,244 (+)	NCBI	ChiLan1.0	ChiLan1.0

DAO
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	116,932,153 - 116,965,615 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	116,928,929 - 116,962,014 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	106,453,807 - 106,475,409 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	109,849,995 - 109,870,065 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	109,849,995 - 109,870,065 (+)	Ensembl	panpan1.1		panPan2

DAO
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	18,032,663 - 18,057,277 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	18,033,392 - 18,057,238 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	17,744,673 - 17,773,938 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	18,371,860 - 18,401,188 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	18,376,518 - 18,395,445 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	17,954,290 - 17,983,467 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	18,362,722 - 18,391,870 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	18,381,507 - 18,410,821 (-)	NCBI		UU_Cfam_GSD_1.0

Dao
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	144,717,426 - 144,736,206 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936769	744,864 - 758,452 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936769	744,862 - 758,086 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DAO
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	41,931,541 - 41,950,633 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	41,931,549 - 41,950,628 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	44,473,515 - 44,492,595 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Pig Cytomap	14	q2.1-q2.3	NCBI

DAO
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	104,080,915 - 104,104,017 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	104,081,672 - 104,106,222 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	140,993,522 - 141,016,334 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dao
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	12,105,133 - 12,116,604 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624747	12,094,658 - 12,117,000 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Dao
157 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	124
Count of miRNA genes:	93
Interacting mature miRNAs:	101
Transcripts:	ENSRNOT00000000881
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
8693635	Alc28	Alcohol consumption QTL 28	2.7	0.439	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	23081340	44726024	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	20328819	46669029	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610870	42828880	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	32103174	45899022	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	28064433	46669029	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	28064433	45899022	Rat
8693658	Alc33	Alcohol consumption QTL 33	2.1	0.68	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	23081340	43551788	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	8	38	79	91	90	59	25	59	6	204	83	59	45	58	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053626	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270980	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270981	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB003400	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088395	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000077317 ⟹ ENSRNOP00000069135

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	42,593,915 - 42,612,741 (-)	Ensembl
Rnor_6.0 Ensembl	12	48,354,196 - 48,365,784 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094356 ⟹ ENSRNOP00000079300

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	42,592,343 - 42,612,741 (-)	Ensembl

RefSeq Acc Id:

NM_053626 ⟹ NP_446078

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	48,252,902 - 48,273,300 (-)	NCBI
mRatBN7.2	12	42,592,343 - 42,612,741 (-)	NCBI
Rnor_6.0	12	48,353,691 - 48,373,647 (-)	NCBI
Rnor_5.0	12	50,135,334 - 50,157,417 (-)	NCBI
RGSC_v3.4	12	43,627,593 - 43,648,332 (-)	RGD
Celera	12	44,196,549 - 44,215,768 (-)	RGD

Sequence:

show sequence

CAACGCAGCCCAGAATCAGGAGCAATCCTGCTGGAGACAGGTTCCTGCACCCCCAGGCCATTTT
TCTCTAGACACTTGGCACCAGCGGCTGGGGTGATGCGCGTGGCCGTGATTGGAGCGGGAGTCAT
CGGACTGTCTACAGCCCTCTGCATTCATGAACGTTACCACCCAGCCCAACCTCTGCACATGAAG
ATCTATGCGGATCGCTTCACGCCGTTCACTACCAGCGATGTGGCTGCGGGACTCTGGCAGCCTT
ATCTCTCTGACCCCAGCAACCCGCAGGAGGCGGAGTGGAACCAGCAAACTTTCGATCACCTTCA
GAGCTGCCTCCATTCTCCAAACGCTGAGAAAATGGGCTTGGCCCTAATCTCAGGCTACAACCTC
TTCCGAGACGAAGTCCCGGACCCTTTCTGGAAAAGCACAGTTCTGGGATTCCGGAAGCTGACCC
CCAGCGAGTTGGACATGTTCCCTGATTATAGCTATGGCTGGTTCAACACGAGCCTCCTTCTTGA
GGGGAAGAGCTACCTATCATGGCTGACTGAGAGGTTAACTGAGAGGGGAGTGAAGTTCATCCAT
CGGAAGGTGGCATCTTTCGAAGAGGTGGTGAGAGGAGGCGTGGATGTGATTATCAACTGCACCG
GGGTGTGGGCCGGGGCTCTGCAAGCAGACGCCTCCCTGCAGCCAGGCCGGGGCCAGATCATCCA
GGTGGAGGCCCCTTGGATAAAGCACTTCATCCTCACCCATGATCCCAGCCTTGGCATCTACAAC
TCTCCATACATCATCCCAGGTTCCAAGACAGTTACACTCGGAGGTGTATTCCAGCTGGGGAACT
GGAGCGAGCTAAACAGCGTCCATGACCACAACACCATTTGGAAGAGCTGCTGTCAACTGGAGCC
CACCCTGAAGAATGCAAGAATCATGGGTGAACTCACTGGCTTCCGGCCAGTCCGACCTCAGGTC
CGGCTAGAAAGAGAACGCCTTCGCTTTGGATCTTCAAGTGCAGAGGTCATCCATAACTATGGTC
ATGGAGGTTACGGGCTCACGATTCACTGGGGTTGTGCAATGGAGGCAGCCAACCTCTTTGGGAA
AATTCTAGAAGAAAAGAACTTGTCCAGGATGCCTCCATCCCACCTCTGAGGACTCTGGTGAATA
CCACTTGCCCCAAGACGACATCCCAACCCCTTCAGCCAGTTGACACCATCCTTGATGATTCCCT
CCCCCAGCCCCAGCCCCTCCTCCAGCACCCCCTTGGCAAAGGCCTGAAGGGAGGAAATCCTGCT
GTTCCCTCTCTGCCTAGTCCTTCCAGGGCAGTGATGCTGGTTGGTTCTAACCAAGGCTGCATGA
GACAGGCGAGATCTACAACCATGATGCAATTCTTCTCACGCTGCAACGACTGTACTAAGGCTGG
TCCTACTGGGTGGCAGGGTCTGTGTTCAGTCTGATAGAGTAGTCTGGAATCTTTTGCTTAGAAC
TCTGATGAACGGTTCACGACACTATCCATGTCTATTTGTAGTGATGGAGTGATGGGAGGAGAGG
GAGGAAGAAGAGGAGGAGGGGGAGGGGGAGGAGGGGGAGGAGGGGGAGGAGGAGGAGGGCTCCC
TCTTCAGCACTCTGCTGGTCAACATCATTAAAGCACTGAATATCCA

hide sequence

RefSeq Acc Id:

XM_039089003 ⟹ XP_038944931

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	48,252,900 - 48,273,667 (-)	NCBI
mRatBN7.2	12	42,592,342 - 42,613,046 (-)	NCBI

RefSeq Acc Id:

XM_063270980 ⟹ XP_063127050

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	48,252,900 - 48,275,964 (-)	NCBI

RefSeq Acc Id:

XM_063270981 ⟹ XP_063127051

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	48,252,900 - 48,273,614 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_446078	(Get FASTA)	NCBI Sequence Viewer
	XP_038944931	(Get FASTA)	NCBI Sequence Viewer
	XP_063127050	(Get FASTA)	NCBI Sequence Viewer
	XP_063127051	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88395	(Get FASTA)	NCBI Sequence Viewer
	BAA22840	(Get FASTA)	NCBI Sequence Viewer
	EDM13954	(Get FASTA)	NCBI Sequence Viewer
	EDM13955	(Get FASTA)	NCBI Sequence Viewer
	EDM13956	(Get FASTA)	NCBI Sequence Viewer
	EDM13957	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000069135.2
	ENSRNOP00000079300.1
GenBank Protein	O35078	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446078 ⟸ NM_053626

- UniProtKB:

O35078 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MRVAVIGAGVIGLSTALCIHERYHPAQPLHMKIYADRFTPFTTSDVAAGLWQPYLSDPSNPQEA
EWNQQTFDHLQSCLHSPNAEKMGLALISGYNLFRDEVPDPFWKSTVLGFRKLTPSELDMFPDYS
YGWFNTSLLLEGKSYLSWLTERLTERGVKFIHRKVASFEEVVRGGVDVIINCTGVWAGALQADA
SLQPGRGQIIQVEAPWIKHFILTHDPSLGIYNSPYIIPGSKTVTLGGVFQLGNWSELNSVHDHN
TIWKSCCQLEPTLKNARIMGELTGFRPVRPQVRLERERLRFGSSSAEVIHNYGHGGYGLTIHWG
CAMEAANLFGKILEEKNLSRMPPSHL

hide sequence

Ensembl Acc Id:

ENSRNOP00000069135 ⟸ ENSRNOT00000077317

RefSeq Acc Id:	XP_038944931 ⟸ XM_039089003
- Peptide Label:	isoform X1
- UniProtKB:	O35078 (UniProtKB/Swiss-Prot)

Ensembl Acc Id:

ENSRNOP00000079300 ⟸ ENSRNOT00000094356

RefSeq Acc Id:	XP_063127050 ⟸ XM_063270980
- Peptide Label:	isoform X1
- UniProtKB:	O35078 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_063127051 ⟸ XM_063270981
- Peptide Label:	isoform X1
- UniProtKB:	O35078 (UniProtKB/Swiss-Prot)

Protein Domains

FAD dependent oxidoreductase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O35078-F1-model_v2	AlphaFold	O35078	1-346	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621138	AgrOrtholog
BioCyc Gene	G2FUF-18935	BioCyc
Ensembl Genes	ENSRNOG00000054962	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000077317.2	UniProtKB/TrEMBL
	ENSRNOT00000094356.1	UniProtKB/Swiss-Prot
Gene3D-CATH	D-Amino Acid Oxidase, subunit A, domain 2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NAD(P)-binding Rossmann-like Domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7110523	IMAGE-MGC_LOAD
InterPro	D-amino_acid_oxidase_CS	UniProtKB/Swiss-Prot
	DAO	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FAD-dep_OxRdtase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:114027	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93293	IMAGE-MGC_LOAD
NCBI Gene	114027	ENTREZGENE
PANTHER	D-AMINO-ACID OXIDASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11530	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	DAO	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Dao	PhenoGen
PIRSF	D-aa_oxidase	UniProtKB/Swiss-Prot
PROSITE	DAO	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000054962	RatGTEx
Superfamily-SCOP	FAD-linked reductases, C-terminal domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Nucleotide-binding domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2JUK6_RAT	UniProtKB/TrEMBL
	O35078	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-25	Dao	D-amino-acid oxidase	Dao1	D-amino acid oxidase 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Dao1	D-amino acid oxidase 1		D-amino acid oxidase	Name updated	1299863	APPROVED
2005-01-20	Dao1	D-amino acid oxidase			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Dao1	D-amino acid oxidase			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in kidney, liver, and brain	632639
gene_homology	93% amino acid identity to mouse homolog	632639
gene_protein	346 amino acids	632639

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)