Symbol:
Dad1
Name:
defender against cell death 1
RGD ID:
621028
Description:
Predicted to enable enzyme activator activity. Involved in response to nutrient and response to xenobiotic stimulus. Predicted to be part of oligosaccharyltransferase complex A and oligosaccharyltransferase complex B. Orthologous to human DAD1 (defender against cell death 1); PARTICIPATES IN Endoplasmic Reticulum-associated degradation pathway; N-linked glycan biosynthetic pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
DAD-1; dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; oligosaccharyl transferase subunit DAD1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
DAD1 (defender against cell death 1) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Dad1 (defender against cell death 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Dad1 (defender against cell death 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
DAD1 (defender against cell death 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
DAD1 (defender against cell death 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Dad1 (defender against cell death 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
DAD1 (defender against cell death 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
DAD1 (defender against cell death 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Dad1 (defender against cell death 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
GPR161 (G protein-coupled receptor 161) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
DAD1 (defender against cell death 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Dad1 (defender against cell death 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
dad1 (defender against cell death 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Dad1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
OST2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
dad-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
dad1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 31,647,326 - 31,667,159 (-) NCBI GRCr8 mRatBN7.2 15 27,677,286 - 27,697,120 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 27,677,268 - 27,697,347 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 29,518,815 - 29,538,699 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 30,665,754 - 30,685,523 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 28,915,796 - 28,935,565 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 32,868,136 - 32,887,933 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 32,868,087 - 32,888,095 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 36,679,088 - 36,699,062 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 32,285,592 - 32,305,885 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 32,301,291 - 32,321,585 (-) NCBI Celera 15 27,259,040 - 27,278,828 (-) NCBI Celera Cytogenetic Map 15 p13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Dad1 Rat 1,2-dimethylhydrazine multiple interactions ISO Dad1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of DAD1 mRNA CTD PMID:22206623 Dad1 Rat 17beta-estradiol increases expression ISO DAD1 (Homo sapiens) 6480464 Estradiol results in increased expression of DAD1 mRNA CTD PMID:16474171 Dad1 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of DAD1 mRNA CTD PMID:32145629 Dad1 Rat 17beta-estradiol affects expression ISO Dad1 (Mus musculus) 6480464 Estradiol affects the expression of DAD1 mRNA CTD PMID:15598610 Dad1 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Dad1 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Dad1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of DAD1 mRNA CTD PMID:19520675 Dad1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of DAD1 mRNA CTD PMID:34747641 Dad1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Dad1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of DAD1 mRNA CTD PMID:21570461 and PMID:24680724 Dad1 Rat 2-bromohexadecanoic acid multiple interactions ISO DAD1 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of DAD1 protein] CTD PMID:38195004 Dad1 Rat 2-hydroxypropanoic acid decreases expression ISO DAD1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of DAD1 mRNA CTD PMID:30851411 Dad1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO DAD1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of DAD1 mRNA CTD PMID:28628672 Dad1 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Dad1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of DAD1 mRNA CTD PMID:18648102 Dad1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO Dad1 (Mus musculus) 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of DAD1 mRNA CTD PMID:30951980 Dad1 Rat 4,4'-sulfonyldiphenol increases expression ISO DAD1 (Homo sapiens) 6480464 bisphenol S results in increased expression of DAD1 protein CTD PMID:34186270 Dad1 Rat 4,4'-sulfonyldiphenol increases expression ISO Dad1 (Mus musculus) 6480464 bisphenol S results in increased expression of DAD1 mRNA CTD PMID:39298647 Dad1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of DAD1 mRNA CTD PMID:30047161 Dad1 Rat acrylamide affects expression EXP 6480464 Acrylamide affects the expression of DAD1 mRNA CTD PMID:28959563 Dad1 Rat aflatoxin B1 increases expression ISO DAD1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of DAD1 mRNA CTD PMID:27153756 Dad1 Rat aflatoxin B1 increases methylation ISO DAD1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of DAD1 gene CTD PMID:27153756 Dad1 Rat all-trans-retinoic acid multiple interactions ISO Dad1 (Mus musculus) 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of DAD1 mRNA more ... CTD PMID:30951980 Dad1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of DAD1 mRNA CTD PMID:30047161 Dad1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of DAD1 mRNA CTD PMID:16483693 Dad1 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of DAD1 mRNA CTD PMID:30779732 Dad1 Rat arsenous acid decreases expression ISO DAD1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of DAD1 protein CTD PMID:25419056 Dad1 Rat azoxystrobin increases expression ISO DAD1 (Homo sapiens) 6480464 azoxystrobin results in increased expression of DAD1 mRNA CTD PMID:33512557 Dad1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Dad1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of DAD1 mRNA CTD PMID:33754040 Dad1 Rat bisphenol A increases expression ISO DAD1 (Homo sapiens) 6480464 bisphenol A results in increased expression of DAD1 mRNA CTD PMID:16474171 Dad1 Rat bisphenol A decreases expression ISO Dad1 (Mus musculus) 6480464 bisphenol A results in decreased expression of DAD1 mRNA CTD PMID:33221593 Dad1 Rat bisphenol A multiple interactions ISO Dad1 (Mus musculus) 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of DAD1 mRNA CTD PMID:30951980 Dad1 Rat bisphenol A affects expression ISO DAD1 (Homo sapiens) 6480464 bisphenol A affects the expression of DAD1 mRNA CTD PMID:30903817 Dad1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of DAD1 mRNA CTD PMID:25181051 and PMID:32145629 Dad1 Rat bisphenol AF increases expression ISO DAD1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of DAD1 protein CTD PMID:34186270 Dad1 Rat Bisphenol B increases expression ISO DAD1 (Homo sapiens) 6480464 bisphenol B results in increased expression of DAD1 protein CTD PMID:34186270 Dad1 Rat bisphenol F multiple interactions ISO DAD1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of DAD1 mRNA CTD PMID:28628672 Dad1 Rat bisphenol F increases expression ISO DAD1 (Homo sapiens) 6480464 bisphenol F results in increased expression of DAD1 protein CTD PMID:34186270 Dad1 Rat bisphenol F multiple interactions ISO Dad1 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of DAD1 mRNA CTD PMID:30951980 Dad1 Rat cadmium acetate affects expression EXP 6480464 cadmium acetate affects the expression of DAD1 mRNA CTD PMID:16249259 Dad1 Rat cadmium atom multiple interactions ISO DAD1 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of DAD1 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of DAD1 protein CTD PMID:38195004 Dad1 Rat cadmium dichloride multiple interactions ISO DAD1 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of DAD1 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of DAD1 protein CTD PMID:38195004 Dad1 Rat cadmium dichloride increases expression ISO DAD1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of DAD1 mRNA CTD PMID:38568856 Dad1 Rat caffeine decreases expression ISO DAD1 (Homo sapiens) 6480464 Caffeine results in decreased expression of DAD1 mRNA CTD PMID:11793227 Dad1 Rat chloropicrin affects expression ISO DAD1 (Homo sapiens) 6480464 chloropicrin affects the expression of DAD1 mRNA CTD PMID:26352163 Dad1 Rat chlorpyrifos increases expression ISO Dad1 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of DAD1 mRNA CTD PMID:37019170 Dad1 Rat cisplatin increases expression ISO DAD1 (Homo sapiens) 6480464 Cisplatin results in increased expression of DAD1 mRNA and Cisplatin results in increased expression of DAD1 protein CTD PMID:21278888 Dad1 Rat clobetasol increases expression ISO Dad1 (Mus musculus) 6480464 Clobetasol results in increased expression of DAD1 mRNA CTD PMID:27462272 Dad1 Rat clofibrate decreases expression ISO Dad1 (Mus musculus) 6480464 Clofibrate results in decreased expression of DAD1 mRNA CTD PMID:17585979 Dad1 Rat cobalt dichloride decreases expression ISO DAD1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of DAD1 mRNA CTD PMID:19376846 Dad1 Rat copper(II) sulfate decreases expression ISO DAD1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of DAD1 mRNA CTD PMID:19549813 Dad1 Rat cyclosporin A increases expression ISO DAD1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of DAD1 mRNA CTD PMID:20106945 Dad1 Rat dexamethasone multiple interactions ISO DAD1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of DAD1 mRNA CTD PMID:28628672 Dad1 Rat diarsenic trioxide decreases expression ISO DAD1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of DAD1 protein CTD PMID:25419056 Dad1 Rat diazinon affects expression EXP 6480464 Diazinon affects the expression of DAD1 mRNA CTD PMID:22546817 Dad1 Rat Dibutyl phosphate affects expression ISO DAD1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of DAD1 mRNA CTD PMID:37042841 Dad1 Rat dieldrin affects expression EXP 6480464 Dieldrin affects the expression of DAD1 mRNA CTD PMID:22546817 Dad1 Rat diethylstilbestrol increases expression ISO DAD1 (Homo sapiens) 6480464 Diethylstilbestrol results in increased expression of DAD1 mRNA CTD PMID:15766595 Dad1 Rat diethylstilbestrol decreases expression ISO DAD1 (Homo sapiens) 6480464 Diethylstilbestrol results in decreased expression of DAD1 mRNA CTD PMID:36621641 Dad1 Rat doxorubicin increases expression ISO DAD1 (Homo sapiens) 6480464 Doxorubicin results in increased expression of DAD1 mRNA CTD PMID:29803840 Dad1 Rat elemental selenium multiple interactions EXP 6480464 [Selenium deficiency co-treated with Vitamin E deficiency] results in decreased expression of DAD1 mRNA CTD PMID:11444866 Dad1 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of DAD1 mRNA CTD PMID:15353170 Dad1 Rat folic acid multiple interactions ISO Dad1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of DAD1 mRNA CTD PMID:22206623 Dad1 Rat genistein increases expression ISO DAD1 (Homo sapiens) 6480464 Genistein results in increased expression of DAD1 mRNA CTD PMID:16474171 Dad1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of DAD1 mRNA CTD PMID:33387578 Dad1 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of DAD1 mRNA CTD PMID:24136188 Dad1 Rat indometacin multiple interactions ISO DAD1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of DAD1 mRNA CTD PMID:28628672 Dad1 Rat ivermectin decreases expression ISO DAD1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of DAD1 protein CTD PMID:32959892 Dad1 Rat Mesaconitine increases expression EXP 6480464 mesaconitine results in increased expression of DAD1 protein CTD PMID:37182599 Dad1 Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of DAD1 mRNA CTD PMID:19564919 Dad1 Rat methamphetamine multiple interactions EXP 6480464 SCH 23390 inhibits the reaction [Methamphetamine results in increased expression of DAD1 mRNA] CTD PMID:19564919 Dad1 Rat methidathion increases expression ISO Dad1 (Mus musculus) 6480464 methidathion results in increased expression of DAD1 mRNA CTD PMID:34813904 Dad1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of DAD1 mRNA CTD PMID:30047161 Dad1 Rat N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine decreases expression ISO DAD1 (Homo sapiens) 6480464 N more ... CTD PMID:12888634 Dad1 Rat N-nitrosodiethylamine decreases expression EXP 6480464 Diethylnitrosamine results in decreased expression of DAD1 mRNA CTD PMID:11323195 Dad1 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of DAD1 mRNA CTD PMID:22546817 Dad1 Rat nitrates multiple interactions ISO Dad1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of DAD1 mRNA CTD PMID:35964746 Dad1 Rat p-menthan-3-ol decreases expression ISO DAD1 (Homo sapiens) 6480464 Menthol results in decreased expression of DAD1 mRNA CTD PMID:26760959 Dad1 Rat paracetamol decreases expression ISO DAD1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of DAD1 mRNA CTD PMID:11793227 Dad1 Rat paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of DAD1 mRNA CTD PMID:33387578 Dad1 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of DAD1 mRNA CTD PMID:16510358 more ... Dad1 Rat picoxystrobin increases expression ISO DAD1 (Homo sapiens) 6480464 picoxystrobin results in increased expression of DAD1 mRNA CTD PMID:33512557 Dad1 Rat poly(vinylpyrrolidone) multiple interactions EXP 6480464 [Silver analog co-treated with Povidone] results in decreased expression of DAD1 mRNA CTD PMID:25194297 Dad1 Rat procymidone decreases expression EXP 6480464 procymidone results in decreased expression of DAD1 mRNA CTD PMID:15686871 Dad1 Rat Propiverine affects binding EXP 6480464 propiverine binds to DAD1 protein CTD PMID:29273565 Dad1 Rat pyrimidifen increases expression ISO DAD1 (Homo sapiens) 6480464 pyrimidifen results in increased expression of DAD1 mRNA CTD PMID:33512557 Dad1 Rat rac-lactic acid decreases expression ISO DAD1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of DAD1 mRNA CTD PMID:30851411 Dad1 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of DAD1 mRNA CTD PMID:28374803 Dad1 Rat rotenone increases expression ISO DAD1 (Homo sapiens) 6480464 Rotenone results in increased expression of DAD1 mRNA CTD PMID:33512557 Dad1 Rat SB 431542 multiple interactions ISO DAD1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of DAD1 protein CTD PMID:37664457 Dad1 Rat SCH 23390 multiple interactions EXP 6480464 SCH 23390 inhibits the reaction [Methamphetamine results in increased expression of DAD1 mRNA] CTD PMID:19564919 Dad1 Rat selenium atom multiple interactions EXP 6480464 [Selenium deficiency co-treated with Vitamin E deficiency] results in decreased expression of DAD1 mRNA CTD PMID:11444866 Dad1 Rat silver atom multiple interactions EXP 6480464 [Silver analog co-treated with Povidone] results in decreased expression of DAD1 mRNA CTD PMID:25194297 Dad1 Rat silver(0) multiple interactions EXP 6480464 [Silver analog co-treated with Povidone] results in decreased expression of DAD1 mRNA CTD PMID:25194297 Dad1 Rat sodium arsenite decreases expression ISO DAD1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of DAD1 mRNA CTD PMID:12760830 Dad1 Rat sodium arsenite increases expression ISO DAD1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of DAD1 mRNA CTD PMID:38568856 Dad1 Rat sodium fluoride decreases expression ISO Dad1 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of DAD1 protein CTD PMID:28918527 Dad1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of DAD1 mRNA CTD PMID:30047161 Dad1 Rat testosterone decreases expression ISO DAD1 (Homo sapiens) 6480464 Testosterone results in decreased expression of DAD1 mRNA CTD PMID:33359661 Dad1 Rat tetrachloroethene decreases expression ISO Dad1 (Mus musculus) 6480464 Tetrachloroethylene results in decreased expression of DAD1 mRNA CTD PMID:28973375 Dad1 Rat tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of DAD1 mRNA CTD PMID:15963342 Dad1 Rat tetrachloromethane increases expression ISO Dad1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of DAD1 mRNA CTD PMID:31919559 Dad1 Rat thioacetamide decreases expression ISO DAD1 (Homo sapiens) 6480464 Thioacetamide results in decreased expression of DAD1 mRNA CTD PMID:11793227 Dad1 Rat titanium dioxide decreases methylation ISO Dad1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of DAD1 gene CTD PMID:35295148 Dad1 Rat triadimefon increases expression EXP 6480464 triadimefon results in increased expression of DAD1 mRNA CTD PMID:30047161 Dad1 Rat trichloroethene increases expression ISO Dad1 (Mus musculus) 6480464 Trichloroethylene results in increased expression of DAD1 mRNA CTD PMID:15363585 Dad1 Rat trichloroethene multiple interactions ISO Dad1 (Mus musculus) 6480464 PPARA protein inhibits the reaction [Trichloroethylene results in increased expression of DAD1 protein] CTD PMID:15363585 Dad1 Rat triphenyl phosphate affects expression ISO DAD1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of DAD1 mRNA CTD PMID:37042841 Dad1 Rat valproic acid affects expression ISO DAD1 (Homo sapiens) 6480464 Valproic Acid affects the expression of DAD1 mRNA CTD PMID:25979313 Dad1 Rat valproic acid increases expression ISO DAD1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of DAD1 mRNA CTD PMID:28001369 Dad1 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of DAD1 mRNA CTD PMID:15686871 Dad1 Rat vitamin E multiple interactions EXP 6480464 [Selenium deficiency co-treated with Vitamin E deficiency] results in decreased expression of DAD1 mRNA CTD PMID:11444866 Dad1 Rat zinc atom multiple interactions ISO Dad1 (Mus musculus) 6480464 [Zinc deficiency promotes the reaction [TRP53 gene mutant form results in increased susceptibility to nitrosobenzylmethylamine]] which results in increased expression of DAD1 mRNA CTD PMID:12517797 Dad1 Rat zinc(0) multiple interactions ISO Dad1 (Mus musculus) 6480464 [Zinc deficiency promotes the reaction [TRP53 gene mutant form results in increased susceptibility to nitrosobenzylmethylamine]] which results in increased expression of DAD1 mRNA CTD PMID:12517797
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-bromohexadecanoic acid (ISO) 2-hydroxypropanoic acid (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) amphetamine (EXP) arsenous acid (ISO) azoxystrobin (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) cadmium acetate (EXP) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) chloropicrin (ISO) chlorpyrifos (ISO) cisplatin (ISO) clobetasol (ISO) clofibrate (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) diazinon (EXP) Dibutyl phosphate (ISO) dieldrin (EXP) diethylstilbestrol (ISO) doxorubicin (ISO) elemental selenium (EXP) ethanol (EXP) folic acid (ISO) genistein (ISO) gentamycin (EXP) glafenine (EXP) indometacin (ISO) ivermectin (ISO) Mesaconitine (EXP) methamphetamine (EXP) methidathion (ISO) methimazole (EXP) N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO) N-nitrosodiethylamine (EXP) nickel dichloride (EXP) nitrates (ISO) p-menthan-3-ol (ISO) paracetamol (EXP,ISO) phenobarbital (EXP) picoxystrobin (ISO) poly(vinylpyrrolidone) (EXP) procymidone (EXP) Propiverine (EXP) pyrimidifen (ISO) rac-lactic acid (ISO) rotenone (EXP,ISO) SB 431542 (ISO) SCH 23390 (EXP) selenium atom (EXP) silver atom (EXP) silver(0) (EXP) sodium arsenite (ISO) sodium fluoride (ISO) sulfadimethoxine (EXP) testosterone (ISO) tetrachloroethene (ISO) tetrachloromethane (EXP,ISO) thioacetamide (ISO) titanium dioxide (ISO) triadimefon (EXP) trichloroethene (ISO) triphenyl phosphate (ISO) valproic acid (ISO) vinclozolin (EXP) vitamin E (EXP) zinc atom (ISO) zinc(0) (ISO)
1.
Effect of selenium and vitamin E deficiency on differential gene expression in rat liver.
Fischer A, etal., Biochem Biophys Res Commun. 2001 Jul 13;285(2):470-5.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
4.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
6.
GOA pipeline
RGD automated data pipeline
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
Comprehensive gene review and curation
RGD comprehensive gene curation
9.
Gene expression analysis in the ventral prostate of rats exposed to vinclozolin or procymidone.
Rosen MB, etal., Reprod Toxicol. 2005 Jan-Feb;19(3):367-79.
10.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Dad1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 31,647,326 - 31,667,159 (-) NCBI GRCr8 mRatBN7.2 15 27,677,286 - 27,697,120 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 27,677,268 - 27,697,347 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 29,518,815 - 29,538,699 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 30,665,754 - 30,685,523 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 28,915,796 - 28,935,565 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 32,868,136 - 32,887,933 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 32,868,087 - 32,888,095 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 36,679,088 - 36,699,062 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 32,285,592 - 32,305,885 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 32,301,291 - 32,321,585 (-) NCBI Celera 15 27,259,040 - 27,278,828 (-) NCBI Celera Cytogenetic Map 15 p13 NCBI
DAD1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 22,564,907 - 22,589,224 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 22,564,907 - 22,589,224 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 23,033,807 - 23,058,130 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 22,103,647 - 22,127,969 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 22,103,646 - 22,127,969 NCBI Celera 14 2,896,859 - 2,921,191 (-) NCBI Celera Cytogenetic Map 14 q11.2 NCBI HuRef 14 3,152,065 - 3,176,551 (-) NCBI HuRef CHM1_1 14 23,032,809 - 23,057,139 (-) NCBI CHM1_1 T2T-CHM13v2.0 14 16,762,628 - 16,786,951 (-) NCBI T2T-CHM13v2.0
Dad1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 54,472,942 - 54,491,386 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 54,472,936 - 54,491,561 (-) Ensembl GRCm39 Ensembl GRCm38 14 54,235,485 - 54,253,929 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 54,235,479 - 54,254,104 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 54,855,160 - 54,873,604 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 53,193,491 - 53,211,877 (-) NCBI MGSCv36 mm8 Celera 14 52,031,369 - 52,050,171 (-) NCBI Celera Cytogenetic Map 14 C2 NCBI cM Map 14 27.7 NCBI
Dad1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955409 37,670,274 - 37,688,391 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955409 37,670,266 - 37,688,226 (+) NCBI ChiLan1.0 ChiLan1.0
DAD1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 24,013,115 - 24,044,990 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 23,229,601 - 23,254,008 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 3,401,048 - 3,425,359 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 21,502,618 - 21,526,793 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 21,502,618 - 21,526,793 (-) Ensembl panpan1.1 panPan2
DAD1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 2,963,719 - 2,984,978 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 2,913,614 - 2,934,653 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 3,071,124 - 3,092,393 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 3,070,735 - 3,092,373 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 2,763,845 - 2,785,098 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 2,825,279 - 2,846,498 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 3,087,258 - 3,108,519 (-) NCBI UU_Cfam_GSD_1.0
Dad1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 34,690,409 - 34,710,031 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936722 1,678,862 - 1,698,579 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936722 1,678,952 - 1,698,583 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DAD1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 76,432,051 - 76,457,192 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 76,432,040 - 76,457,403 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 81,668,608 - 81,693,971 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DAD1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 29 22,935,231 - 22,958,331 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 29 22,935,005 - 22,958,414 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 23,465,308 - 23,488,458 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Dad1
.
Predicted Target Of
Count of predictions: 50 Count of miRNA genes: 40 Interacting mature miRNAs: 47 Transcripts: ENSRNOT00000012233 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331729 Rf42 Renal function QTL 42 3.071 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 15 17362897 73690657 Rat 1641887 Alcrsp14 Alcohol response QTL 14 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 15 1 42356671 Rat 10755503 Bp391 Blood pressure QTL 391 2.37 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 15 20248600 37896129 Rat 1578646 Bmd18 Bone mineral density QTL 18 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 15 22806240 98288169 Rat 9589149 Insul29 Insulin level QTL 29 9.06 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 15 1 34723002 Rat 1578647 Bmd17 Bone mineral density QTL 17 4 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 15 22806240 98288169 Rat 10401805 Kidm51 Kidney mass QTL 51 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 15 306329 45306329 Rat 2317750 Glom26 Glomerulus QTL 26 4.3 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 15 12496141 65205939 Rat 2298549 Neuinf12 Neuroinflammation QTL 12 3.5 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 15 1 55302115 Rat 8552920 Pigfal8 Plasma insulin-like growth factor 1 level QTL 8 3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 15 1 34723002 Rat 2293688 Bss29 Bone structure and strength QTL 29 5.31 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 15 11111142 56111142 Rat 5685002 Bss103 Bone structure and strength QTL 103 2.8 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 15 14481165 28469888 Rat 8694361 Abfw6 Abdominal fat weight QTL 6 10.2 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 15 1 34723002 Rat 631273 Lecl2 Lens clarity QTL 2 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 15 10596089 55596089 Rat 2300167 Bmd63 Bone mineral density QTL 63 5.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 731170 Pur3 Proteinuria QTL 3 2.3 0.0005 urine protein amount (VT:0005160) urine protein excretion rate (CMO:0000759) 15 1 41686771 Rat 738017 Hcas7 Hepatocarcinoma susceptibility QTL 7 2.91 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 15 2266368 46921453 Rat 10054130 Srcrt8 Stress Responsive Cort QTL 8 2.18 0.0085 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 15 22117933 67117933 Rat 2300173 Bmd62 Bone mineral density QTL 62 12.8 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 2324620 Coatc3 Coat color QTL 3 coat/hair pigmentation trait (VT:0010463) pigmented coat/hair area to total coat/hair area ratio (CMO:0001810) 15 19856566 46187442 Rat 61424 Scl1 Serum cholesterol level QTL 1 7.7 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 15 16725528 80672115 Rat 1582251 Gluco24 Glucose level QTL 24 3.2 0.0008 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 15 5530756 50530756 Rat 1354657 Despr13 Despair related QTL 13 0.0022 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 15 1 29912054 Rat 631550 Bw7 Body weight QTL 7 3.6 body mass (VT:0001259) body weight (CMO:0000012) 15 19856566 34924750 Rat 1578660 Bss19 Bone structure and strength QTL 19 4.3 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 15 22806240 98288169 Rat
AW557067
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 27,685,287 - 27,685,437 (+) MAPPER mRatBN7.2 Rnor_6.0 15 32,876,138 - 32,876,287 NCBI Rnor6.0 Rnor_5.0 15 36,687,267 - 36,687,416 UniSTS Rnor5.0 RGSC_v3.4 15 32,294,087 - 32,294,236 UniSTS RGSC3.4 Celera 15 27,267,033 - 27,267,182 UniSTS Cytogenetic Map 15 p13 UniSTS
RH133381
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 24,859,980 - 24,860,177 (+) MAPPER mRatBN7.2 mRatBN7.2 15 27,691,609 - 27,691,806 (+) MAPPER mRatBN7.2 Rnor_6.0 15 32,882,459 - 32,882,655 NCBI Rnor6.0 Rnor_6.0 2 23,236,683 - 23,236,879 NCBI Rnor6.0 Rnor_5.0 15 36,693,588 - 36,693,784 UniSTS Rnor5.0 Rnor_5.0 2 42,418,108 - 42,418,304 UniSTS Rnor5.0 RGSC_v3.4 2 23,923,761 - 23,923,957 UniSTS RGSC3.4 RGSC_v3.4 15 32,300,411 - 32,300,607 UniSTS RGSC3.4 Celera 15 27,273,354 - 27,273,550 UniSTS Celera 2 20,935,169 - 20,935,365 UniSTS Cytogenetic Map 2 q12 UniSTS Cytogenetic Map 15 p13 UniSTS
UniSTS:99121
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 27,696,876 - 27,696,986 (+) MAPPER mRatBN7.2 Rnor_6.0 15 32,887,726 - 32,887,835 NCBI Rnor6.0 Rnor_5.0 15 36,698,855 - 36,698,964 UniSTS Rnor5.0 RGSC_v3.4 15 32,305,678 - 32,305,787 UniSTS RGSC3.4 Celera 15 27,278,621 - 27,278,730 UniSTS Cytogenetic Map 15 p13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012233 ⟹ ENSRNOP00000012233
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 27,677,268 - 27,697,347 (-) Ensembl Rnor_6.0 Ensembl 15 32,868,087 - 32,888,095 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000098684 ⟹ ENSRNOP00000092852
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 27,677,289 - 27,697,136 (-) Ensembl
RefSeq Acc Id:
NM_001393807 ⟹ NP_001380736
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 31,647,326 - 31,667,159 (-) NCBI mRatBN7.2 15 27,677,286 - 27,697,120 (-) NCBI
RefSeq Acc Id:
NM_138910 ⟹ NP_620265
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 31,647,326 - 31,667,159 (-) NCBI mRatBN7.2 15 27,677,286 - 27,697,120 (-) NCBI Rnor_6.0 15 32,868,136 - 32,887,933 (-) NCBI Rnor_5.0 15 36,679,088 - 36,699,062 (-) NCBI RGSC_v3.4 15 32,285,592 - 32,305,885 (-) RGD Celera 15 27,259,040 - 27,278,828 (-) RGD
Sequence:
GTGTTCGTCCGGTATCCGAAGTTCCCGGGTTCGTCATGTCGGCGTCTGTGGTGTCCGTCATCTCCCGGTTCCTGGAGGAGTACTTGAGCTCCACTCCACAGCGGCTGAAGTTGCTGGATGCCTATCTC
hide sequence
RefSeq Acc Id:
NP_620265 ⟸ NM_138910
- Peptide Label:
isoform 2
- UniProtKB:
P61805 (UniProtKB/Swiss-Prot), A6KGR8 (UniProtKB/TrEMBL)
- Sequence:
MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG
hide sequence
Ensembl Acc Id:
ENSRNOP00000012233 ⟸ ENSRNOT00000012233
Ensembl Acc Id:
ENSRNOP00000092852 ⟸ ENSRNOT00000098684
RefSeq Acc Id:
NP_001380736 ⟸ NM_001393807
- Peptide Label:
isoform 1
- UniProtKB:
A0A8L2Q6I7 (UniProtKB/TrEMBL)
RGD ID: 13699646 Promoter ID: EPDNEW_R10169 Type: initiation region Name: Dad1_1 Description: defender against cell death 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 15 32,887,933 - 32,887,993 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Dad1
defender against cell death 1
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Dad1
defender against cell death 1
Symbol and Name status set to provisional
70820 PROVISIONAL
