Symbol:
Stx3
Name:
syntaxin 3
RGD ID:
621005
Description:
Enables SNAP receptor activity and arachidonate binding activity. Involved in membrane fusion and neuron projection development. Located in growth cone and plasma membrane. Part of SNARE complex. Human ortholog(s) of this gene implicated in congenital diarrhea. Orthologous to human STX3 (syntaxin 3); INTERACTS WITH 1-benzylpiperazine; 17beta-estradiol; acetamide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Stx3a; syntaxin-3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
STX3 (syntaxin 3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Stx3 (syntaxin 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Stx3 (syntaxin 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
STX3 (syntaxin 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
STX3 (syntaxin 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Stx3 (syntaxin 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
STX3 (syntaxin 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
STX3 (syntaxin 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Stx3 (syntaxin 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Stx3 (syntaxin 3)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
STX3 (syntaxin 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
stx3a (syntaxin 3A)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
zgc:165520
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Syx1A
Alliance
DIOPT (Ensembl Compara|Hieranoid|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
SSO1
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoInspector|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
SSO2
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoInspector|PANTHER)
Caenorhabditis elegans (roundworm):
unc-64
Alliance
DIOPT (Ensembl Compara|Hieranoid|PANTHER)
Xenopus tropicalis (tropical clawed frog):
stx3
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 217,940,697 - 218,114,865 (-) NCBI GRCr8 mRatBN7.2 1 208,617,018 - 208,686,240 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 208,639,115 - 208,685,805 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 217,017,514 - 217,060,397 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 224,004,990 - 224,047,866 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 216,771,951 - 216,814,831 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 228,137,781 - 228,195,004 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 228,149,867 - 228,194,977 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 235,205,648 - 235,262,820 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 214,554,512 - 214,597,396 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 214,712,944 - 214,755,826 (-) NCBI Celera 1 206,113,799 - 206,156,646 (-) NCBI Celera Cytogenetic Map 1 q43 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Stx3 Rat (1->4)-beta-D-glucan multiple interactions ISO Stx3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of STX3 mRNA CTD PMID:36331819 Stx3 Rat 1,2-dimethylhydrazine multiple interactions ISO Stx3 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of STX3 mRNA CTD PMID:22206623 Stx3 Rat 1,2-dimethylhydrazine affects expression ISO Stx3 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of STX3 mRNA CTD PMID:22206623 Stx3 Rat 1-benzylpiperazine increases expression EXP 6480464 N-benzylpiperazine results in increased expression of STX3 mRNA CTD PMID:26821219 Stx3 Rat 14-Deoxy-11,12-didehydroandrographolide increases expression ISO STX3 (Homo sapiens) 6480464 14-deoxy-11 and 12-didehydroandrographolide results in increased expression of STX3 mRNA CTD PMID:22101062 Stx3 Rat 17alpha-ethynylestradiol increases expression ISO Stx3 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of STX3 mRNA CTD PMID:17942748 Stx3 Rat 17alpha-ethynylestradiol multiple interactions ISO Stx3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of STX3 mRNA CTD PMID:17942748 Stx3 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of STX3 mRNA CTD PMID:26496021 Stx3 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO STX3 (Homo sapiens) 6480464 2 more ... CTD PMID:19095052 Stx3 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Stx3 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Stx3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Stx3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of STX3 mRNA CTD PMID:17942748 Stx3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Stx3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of STX3 mRNA CTD PMID:21570461 and PMID:26377647 Stx3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Stx3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of STX3 mRNA CTD PMID:19465110 Stx3 Rat 2-palmitoylglycerol increases expression ISO STX3 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of STX3 mRNA CTD PMID:37199045 Stx3 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO Stx3 (Mus musculus) 6480464 tetrabromobisphenol A results in increased expression of STX3 mRNA CTD PMID:25172293 Stx3 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Stx3 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of STX3 mRNA CTD PMID:20188158 Stx3 Rat 4-hydroxyphenyl retinamide increases expression ISO Stx3 (Mus musculus) 6480464 Fenretinide results in increased expression of STX3 mRNA CTD PMID:28973697 Stx3 Rat 5-aza-2'-deoxycytidine affects expression ISO STX3 (Homo sapiens) 6480464 Decitabine affects the expression of STX3 mRNA CTD PMID:23300844 Stx3 Rat 8-Br-cAMP decreases expression ISO STX3 (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in decreased expression of STX3 mRNA CTD PMID:22079614 Stx3 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of STX3 mRNA CTD PMID:31881176 Stx3 Rat acetazolamide increases expression ISO Stx3 (Mus musculus) 6480464 Acetazolamide results in increased expression of STX3 mRNA CTD PMID:19274763 Stx3 Rat acrolein multiple interactions ISO STX3 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in decreased expression of STX3 mRNA CTD PMID:32845096 Stx3 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of STX3 mRNA CTD PMID:28959563 Stx3 Rat acrylamide increases expression ISO STX3 (Homo sapiens) 6480464 Acrylamide results in increased expression of STX3 mRNA CTD PMID:32763439 Stx3 Rat aflatoxin B1 increases expression ISO Stx3 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of STX3 mRNA CTD PMID:19770486 Stx3 Rat all-trans-retinoic acid increases expression ISO Stx3 (Mus musculus) 6480464 Tretinoin results in increased expression of STX3 mRNA CTD PMID:16236135 Stx3 Rat all-trans-retinoic acid increases expression ISO STX3 (Homo sapiens) 6480464 Tretinoin results in increased expression of STX3 mRNA CTD PMID:33167477 Stx3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of STX3 mRNA CTD PMID:16483693 Stx3 Rat arsane decreases expression ISO Stx3 (Mus musculus) 6480464 Arsenic results in decreased expression of STX3 mRNA CTD PMID:19654921 Stx3 Rat arsane multiple interactions ISO STX3 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of STX3 mRNA CTD PMID:32525701 Stx3 Rat arsane affects methylation ISO STX3 (Homo sapiens) 6480464 Arsenic affects the methylation of STX3 gene CTD PMID:25304211 Stx3 Rat arsenic atom decreases expression ISO Stx3 (Mus musculus) 6480464 Arsenic results in decreased expression of STX3 mRNA CTD PMID:19654921 Stx3 Rat arsenic atom multiple interactions ISO STX3 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of STX3 mRNA CTD PMID:32525701 Stx3 Rat arsenic atom affects methylation ISO STX3 (Homo sapiens) 6480464 Arsenic affects the methylation of STX3 gene CTD PMID:25304211 Stx3 Rat azathioprine increases expression ISO STX3 (Homo sapiens) 6480464 Azathioprine results in increased expression of STX3 mRNA CTD PMID:22623647 Stx3 Rat benzene decreases expression ISO Stx3 (Mus musculus) 6480464 Benzene results in decreased expression of STX3 mRNA CTD PMID:15120971 Stx3 Rat benzo[a]pyrene increases expression ISO Stx3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of STX3 mRNA CTD PMID:19770486 and PMID:22228805 Stx3 Rat benzo[a]pyrene increases expression ISO STX3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of STX3 mRNA CTD PMID:22316170 and PMID:26238291 Stx3 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of STX3 mRNA CTD PMID:26496021 Stx3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of STX3 mRNA CTD PMID:30816183 Stx3 Rat bisphenol A affects expression ISO STX3 (Homo sapiens) 6480464 bisphenol A affects the expression of STX3 mRNA CTD PMID:30903817 Stx3 Rat bisphenol A increases expression ISO STX3 (Homo sapiens) 6480464 bisphenol A results in increased expression of STX3 mRNA CTD PMID:27685785 Stx3 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of STX3 mRNA CTD PMID:25181051 Stx3 Rat bisphenol F increases expression ISO Stx3 (Mus musculus) 6480464 bisphenol F results in increased expression of STX3 mRNA CTD PMID:38685157 Stx3 Rat boron nitride increases expression ISO STX3 (Homo sapiens) 6480464 boron nitride results in increased expression of STX3 mRNA CTD PMID:30644070 Stx3 Rat cadmium dichloride increases expression ISO STX3 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of STX3 mRNA CTD PMID:26472689 and PMID:38568856 Stx3 Rat carbamazepine affects expression ISO STX3 (Homo sapiens) 6480464 Carbamazepine affects the expression of STX3 mRNA CTD PMID:25979313 Stx3 Rat carbon nanotube increases expression ISO Stx3 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of STX3 mRNA CTD PMID:25554681 Stx3 Rat chlordecone decreases expression ISO Stx3 (Mus musculus) 6480464 Chlordecone results in decreased expression of STX3 mRNA CTD PMID:33711761 Stx3 Rat choline multiple interactions ISO Stx3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of STX3 mRNA CTD PMID:20938992 Stx3 Rat cisplatin affects expression ISO STX3 (Homo sapiens) 6480464 Cisplatin affects the expression of STX3 mRNA CTD PMID:23300844 Stx3 Rat cisplatin increases expression ISO STX3 (Homo sapiens) 6480464 Cisplatin results in increased expression of STX3 mRNA CTD PMID:27594783 Stx3 Rat clofibrate increases expression ISO Stx3 (Mus musculus) 6480464 Clofibrate results in increased expression of STX3 mRNA CTD PMID:25270620 Stx3 Rat copper atom multiple interactions ISO STX3 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of STX3 mRNA and [NSC 689534 binds to Copper] which results in increased expression of STX3 mRNA CTD PMID:20971185 and PMID:24690739 Stx3 Rat copper(0) multiple interactions ISO STX3 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of STX3 mRNA and [NSC 689534 binds to Copper] which results in increased expression of STX3 mRNA CTD PMID:20971185 and PMID:24690739 Stx3 Rat copper(II) sulfate increases expression ISO STX3 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of STX3 mRNA CTD PMID:19549813 Stx3 Rat corosolic acid increases expression ISO STX3 (Homo sapiens) 6480464 corosolic acid results in increased expression of STX3 mRNA CTD PMID:37939859 Stx3 Rat coumestrol multiple interactions ISO STX3 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of STX3 mRNA CTD PMID:19167446 Stx3 Rat crocidolite asbestos increases expression ISO STX3 (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of STX3 mRNA CTD PMID:18687144 Stx3 Rat curcumin multiple interactions ISO Stx3 (Mus musculus) 6480464 [Docosahexaenoic Acids co-treated with Curcumin] results in increased expression of STX3 mRNA CTD PMID:22911773 Stx3 Rat cyclosporin A increases expression ISO STX3 (Homo sapiens) 6480464 Cyclosporine results in increased expression of STX3 mRNA CTD PMID:20106945 and PMID:25562108 Stx3 Rat D-penicillamine increases expression EXP 6480464 Penicillamine results in increased expression of STX3 mRNA CTD PMID:19575532 Stx3 Rat D-penicillamine decreases expression EXP 6480464 Penicillamine results in decreased expression of STX3 mRNA CTD PMID:19575532 Stx3 Rat DDE decreases expression ISO STX3 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of STX3 mRNA CTD PMID:38568856 Stx3 Rat Dibutyl phosphate affects expression ISO STX3 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of STX3 mRNA CTD PMID:37042841 Stx3 Rat dibutyl phthalate increases expression ISO Stx3 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of STX3 mRNA CTD PMID:17361019 and PMID:21266533 Stx3 Rat disulfiram multiple interactions ISO STX3 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of STX3 mRNA CTD PMID:24690739 Stx3 Rat diuron decreases expression ISO STX3 (Homo sapiens) 6480464 Diuron results in decreased expression of STX3 mRNA CTD PMID:35967413 Stx3 Rat dorsomorphin multiple interactions ISO STX3 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Stx3 Rat doxorubicin decreases response to substance ISO STX3 (Homo sapiens) 6480464 STX3 mRNA results in decreased susceptibility to Doxorubicin CTD PMID:16322897 Stx3 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of STX3 mRNA CTD PMID:29391264 Stx3 Rat Enterolactone multiple interactions ISO STX3 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of STX3 mRNA CTD PMID:19167446 Stx3 Rat ethyl methanesulfonate increases expression ISO STX3 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of STX3 mRNA CTD PMID:23649840 Stx3 Rat fluoranthene multiple interactions ISO Stx3 (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in increased expression of STX3 mRNA CTD PMID:28329830 Stx3 Rat folic acid multiple interactions ISO Stx3 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Stx3 Rat folic acid decreases expression ISO Stx3 (Mus musculus) 6480464 Folic Acid results in decreased expression of STX3 mRNA CTD PMID:25629700 Stx3 Rat folic acid decreases expression ISO STX3 (Homo sapiens) 6480464 Folic Acid results in decreased expression of STX3 mRNA CTD PMID:21867686 Stx3 Rat formaldehyde increases expression ISO STX3 (Homo sapiens) 6480464 Formaldehyde results in increased expression of STX3 mRNA CTD PMID:23649840 Stx3 Rat FR900359 decreases phosphorylation ISO STX3 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of STX3 protein CTD PMID:37730182 Stx3 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of STX3 mRNA CTD PMID:33387578 Stx3 Rat glycidol increases methylation EXP 6480464 glycidol results in increased methylation of STX3 promoter CTD PMID:33150595 Stx3 Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of STX3 mRNA CTD PMID:33150645 Stx3 Rat hydrogen cyanide increases expression ISO Stx3 (Mus musculus) 6480464 Hydrogen Cyanide results in increased expression of STX3 mRNA CTD PMID:33914522 Stx3 Rat iron dichloride increases expression ISO STX3 (Homo sapiens) 6480464 ferrous chloride results in increased expression of STX3 mRNA CTD PMID:35984750 Stx3 Rat isoprenaline increases expression ISO Stx3 (Mus musculus) 6480464 Isoproterenol results in increased expression of STX3 mRNA CTD PMID:20003209 Stx3 Rat L-methionine multiple interactions ISO Stx3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of STX3 mRNA CTD PMID:20938992 Stx3 Rat leflunomide increases expression ISO STX3 (Homo sapiens) 6480464 leflunomide results in increased expression of STX3 mRNA CTD PMID:28988120 Stx3 Rat mercury dibromide increases expression ISO STX3 (Homo sapiens) 6480464 mercuric bromide results in increased expression of STX3 mRNA CTD PMID:26272509 Stx3 Rat mercury dibromide multiple interactions ISO STX3 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of STX3 mRNA CTD PMID:27188386 Stx3 Rat methyl methanesulfonate increases expression ISO STX3 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of STX3 mRNA CTD PMID:23649840 Stx3 Rat methylmercury chloride increases expression ISO STX3 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of STX3 mRNA CTD PMID:28001369 Stx3 Rat N-methyl-4-phenylpyridinium increases expression ISO STX3 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of STX3 mRNA CTD PMID:24810058 Stx3 Rat N-nitrosodimethylamine increases expression ISO STX3 (Homo sapiens) 6480464 Dimethylnitrosamine results in increased expression of STX3 mRNA CTD PMID:17547211 Stx3 Rat nickel dichloride increases expression ISO STX3 (Homo sapiens) 6480464 nickel chloride results in increased expression of STX3 mRNA CTD PMID:17547211 Stx3 Rat niclosamide increases expression ISO STX3 (Homo sapiens) 6480464 Niclosamide results in increased expression of STX3 mRNA CTD PMID:36318118 Stx3 Rat ochratoxin A increases expression EXP 6480464 ochratoxin A results in increased expression of STX3 mRNA CTD PMID:23358140 Stx3 Rat ozone multiple interactions ISO STX3 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in decreased expression of STX3 mRNA and [Air Pollutants results in increased abundance of Ozone] which affects the expression of STX3 mRNA CTD PMID:32845096 and PMID:35430440 Stx3 Rat p-chloromercuribenzoic acid increases expression ISO STX3 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in increased expression of STX3 mRNA CTD PMID:26272509 Stx3 Rat p-chloromercuribenzoic acid multiple interactions ISO STX3 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of STX3 mRNA CTD PMID:27188386 Stx3 Rat paracetamol affects expression ISO Stx3 (Mus musculus) 6480464 Acetaminophen affects the expression of STX3 mRNA CTD PMID:17562736 Stx3 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of STX3 mRNA CTD PMID:33387578 Stx3 Rat paracetamol increases expression ISO STX3 (Homo sapiens) 6480464 Acetaminophen results in increased expression of STX3 mRNA CTD PMID:22230336 Stx3 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Stx3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of STX3 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of STX3 mRNA CTD PMID:36331819 Stx3 Rat phenylmercury acetate increases expression ISO STX3 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of STX3 mRNA CTD PMID:26272509 Stx3 Rat phenylmercury acetate multiple interactions ISO STX3 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of STX3 mRNA CTD PMID:27188386 Stx3 Rat potassium cyanide increases expression ISO Stx3 (Mus musculus) 6480464 Potassium Cyanide results in increased expression of STX3 mRNA CTD PMID:33914522 Stx3 Rat potassium dichromate increases expression ISO STX3 (Homo sapiens) 6480464 Potassium Dichromate results in increased expression of STX3 mRNA and Potassium Dichromate results in increased expression of STX3 protein CTD PMID:11678601 and PMID:23718831 Stx3 Rat progesterone increases expression ISO STX3 (Homo sapiens) 6480464 Progesterone results in increased expression of STX3 mRNA CTD PMID:18037150 Stx3 Rat quercetin increases expression ISO STX3 (Homo sapiens) 6480464 Quercetin results in increased expression of STX3 mRNA CTD PMID:21632981 Stx3 Rat resveratrol multiple interactions ISO STX3 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of STX3 mRNA CTD PMID:23557933 Stx3 Rat rotenone increases expression ISO STX3 (Homo sapiens) 6480464 Rotenone results in increased expression of STX3 mRNA CTD PMID:29955902 Stx3 Rat SB 431542 multiple interactions ISO STX3 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Stx3 Rat Se-methyl-L-selenocysteine increases expression ISO STX3 (Homo sapiens) 6480464 selenomethylselenocysteine results in increased expression of STX3 mRNA CTD PMID:18514395 Stx3 Rat Se-methylselenocysteine increases expression ISO STX3 (Homo sapiens) 6480464 selenomethylselenocysteine results in increased expression of STX3 mRNA CTD PMID:18514395 Stx3 Rat silicon dioxide increases expression ISO STX3 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of STX3 mRNA CTD PMID:25351596 Stx3 Rat silver atom increases expression ISO Stx3 (Mus musculus) 6480464 Silver results in increased expression of STX3 mRNA CTD PMID:27131904 Stx3 Rat silver atom increases expression ISO STX3 (Homo sapiens) 6480464 Silver results in increased expression of STX3 mRNA CTD PMID:26014281 Stx3 Rat silver(0) increases expression ISO Stx3 (Mus musculus) 6480464 Silver results in increased expression of STX3 mRNA CTD PMID:27131904 Stx3 Rat silver(0) increases expression ISO STX3 (Homo sapiens) 6480464 Silver results in increased expression of STX3 mRNA CTD PMID:26014281 Stx3 Rat sodium arsenate multiple interactions ISO STX3 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of STX3 mRNA CTD PMID:32525701 Stx3 Rat sodium arsenite increases expression ISO STX3 (Homo sapiens) 6480464 sodium arsenite results in increased expression of STX3 mRNA CTD PMID:38568856 Stx3 Rat testosterone decreases expression ISO Stx3 (Mus musculus) 6480464 Testosterone deficiency results in decreased expression of STX3 mRNA CTD PMID:33848595 Stx3 Rat tetrachloromethane affects expression ISO Stx3 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of STX3 mRNA CTD PMID:17484886 Stx3 Rat tetrachloromethane increases expression ISO Stx3 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of STX3 mRNA CTD PMID:27339419 and PMID:31919559 Stx3 Rat thapsigargin increases expression ISO STX3 (Homo sapiens) 6480464 Thapsigargin results in increased expression of STX3 mRNA CTD PMID:29453283 Stx3 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of STX3 mRNA CTD PMID:34492290 Stx3 Rat thiram increases expression ISO STX3 (Homo sapiens) 6480464 Thiram results in increased expression of STX3 mRNA CTD PMID:38568856 Stx3 Rat titanium dioxide decreases methylation ISO Stx3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of STX3 gene and titanium dioxide results in decreased methylation of STX3 promoter CTD PMID:35295148 Stx3 Rat triphenyl phosphate affects expression ISO STX3 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of STX3 mRNA CTD PMID:37042841 Stx3 Rat troglitazone increases expression ISO STX3 (Homo sapiens) 6480464 Troglitazone results in increased expression of STX3 mRNA CTD PMID:19140230 Stx3 Rat tunicamycin increases expression ISO STX3 (Homo sapiens) 6480464 Tunicamycin results in increased expression of STX3 mRNA CTD PMID:22378314 and PMID:29453283 Stx3 Rat urethane increases expression ISO STX3 (Homo sapiens) 6480464 Urethane results in increased expression of STX3 mRNA CTD PMID:28818685 Stx3 Rat valproic acid increases expression ISO STX3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of STX3 mRNA CTD PMID:23179753 and PMID:28001369 Stx3 Rat valproic acid increases methylation EXP 6480464 Valproic Acid results in increased methylation of STX3 promoter CTD PMID:33150595 Stx3 Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of STX3 mRNA CTD PMID:33150595 Stx3 Rat valproic acid decreases expression ISO Stx3 (Mus musculus) 6480464 Valproic Acid results in decreased expression of STX3 mRNA CTD PMID:24896083 Stx3 Rat zinc atom multiple interactions ISO STX3 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of STX3 mRNA CTD PMID:18593933 Stx3 Rat zinc(0) multiple interactions ISO STX3 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of STX3 mRNA CTD PMID:18593933
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1-benzylpiperazine (EXP) 14-Deoxy-11,12-didehydroandrographolide (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2-palmitoylglycerol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 8-Br-cAMP (ISO) acetamide (EXP) acetazolamide (ISO) acrolein (ISO) acrylamide (EXP,ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) azathioprine (ISO) benzene (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) boron nitride (ISO) cadmium dichloride (ISO) carbamazepine (ISO) carbon nanotube (ISO) chlordecone (ISO) choline (ISO) cisplatin (ISO) clofibrate (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) corosolic acid (ISO) coumestrol (ISO) crocidolite asbestos (ISO) curcumin (ISO) cyclosporin A (ISO) D-penicillamine (EXP) DDE (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) disulfiram (ISO) diuron (ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) Enterolactone (ISO) ethyl methanesulfonate (ISO) fluoranthene (ISO) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) gentamycin (EXP) glycidol (EXP) hydrogen cyanide (ISO) iron dichloride (ISO) isoprenaline (ISO) L-methionine (ISO) leflunomide (ISO) mercury dibromide (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodimethylamine (ISO) nickel dichloride (ISO) niclosamide (ISO) ochratoxin A (EXP) ozone (ISO) p-chloromercuribenzoic acid (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) phenylmercury acetate (ISO) potassium cyanide (ISO) potassium dichromate (ISO) progesterone (ISO) quercetin (ISO) resveratrol (ISO) rotenone (ISO) SB 431542 (ISO) Se-methyl-L-selenocysteine (ISO) Se-methylselenocysteine (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenate (ISO) sodium arsenite (ISO) testosterone (ISO) tetrachloromethane (ISO) thapsigargin (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) troglitazone (ISO) tunicamycin (ISO) urethane (ISO) valproic acid (EXP,ISO) zinc atom (ISO) zinc(0) (ISO)
1.
The syntaxin family of vesicular transport receptors.
Bennett MK, etal., Cell 1993 Sep 10;74(5):863-73.
2.
Antigen retrieval reveals widespread basolateral expression of syntaxin 3 in renal epithelia.
Breton S, etal., Am J Physiol Renal Physiol 2002 Mar;282(3):F523-9.
3.
Omega-3 and omega-6 fatty acids stimulate cell membrane expansion by acting on syntaxin 3.
Darios F and Davletov B, Nature. 2006 Apr 6;440(7085):813-7.
4.
Accumulation of non-outer segment proteins in the outer segment underlies photoreceptor degeneration in Bardet-Biedl syndrome.
Datta P, etal., Proc Natl Acad Sci U S A. 2015 Aug 11;112(32):E4400-9. doi: 10.1073/pnas.1510111112. Epub 2015 Jul 27.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
A novel ubiquitous form of Munc-18 interacts with multiple syntaxins. Use of the yeast two-hybrid system to study interactions between proteins involved in membrane traffic.
Hata Y and Sudhof TC, J Biol Chem 1995 Jun 2;270(22):13022-8.
7.
A cytosolic splice variant of Cab45 interacts with Munc18b and impacts on amylase secretion by pancreatic acini.
Lam PP, etal., Mol Biol Cell. 2007 Jul;18(7):2473-80. Epub 2007 Apr 18.
8.
Ca(2+)-dependent and -independent activities of neural and non-neural synaptotagmins.
Li C, etal., Nature 1995 Jun 15;375(6532):594-9.
9.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
10.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.
GOA pipeline
RGD automated data pipeline
12.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Membrane fusion between liposomes containing SNARE proteins involved in mast cell exocytosis.
Sakiyama H, etal., Inflamm Res. 2009 Mar;58(3):139-42.
15.
Functional and biochemical analysis of the C2 domains of synaptotagmin IV.
Thomas DM, etal., Mol Biol Cell. 1999 Jul;10(7):2285-95.
Stx3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 217,940,697 - 218,114,865 (-) NCBI GRCr8 mRatBN7.2 1 208,617,018 - 208,686,240 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 208,639,115 - 208,685,805 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 217,017,514 - 217,060,397 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 224,004,990 - 224,047,866 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 216,771,951 - 216,814,831 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 228,137,781 - 228,195,004 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 228,149,867 - 228,194,977 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 235,205,648 - 235,262,820 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 214,554,512 - 214,597,396 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 214,712,944 - 214,755,826 (-) NCBI Celera 1 206,113,799 - 206,156,646 (-) NCBI Celera Cytogenetic Map 1 q43 NCBI
STX3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 59,754,188 - 59,805,878 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 59,713,456 - 59,805,882 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 59,522,849 - 59,573,351 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 59,279,465 - 59,326,755 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 59,279,464 - 59,326,752 NCBI Celera 11 56,885,275 - 56,936,097 (+) NCBI Celera Cytogenetic Map 11 q12.1 NCBI HuRef 11 55,870,047 - 55,920,737 (+) NCBI HuRef CHM1_1 11 59,388,526 - 59,439,344 (+) NCBI CHM1_1 T2T-CHM13v2.0 11 59,706,662 - 59,757,169 (+) NCBI T2T-CHM13v2.0
Stx3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 11,752,482 - 11,798,933 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 11,752,482 - 11,796,767 (-) Ensembl GRCm39 Ensembl GRCm38 19 11,775,118 - 11,821,569 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 11,775,118 - 11,819,403 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 11,849,608 - 11,893,893 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 11,842,163 - 11,886,448 (-) NCBI MGSCv36 mm8 Celera 19 12,449,207 - 12,493,664 (-) NCBI Celera Cytogenetic Map 19 A NCBI cM Map 19 8.52 NCBI
Stx3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955511 4,196,114 - 4,218,961 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955511 4,183,210 - 4,219,528 (+) NCBI ChiLan1.0 ChiLan1.0
STX3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 60,883,565 - 60,933,584 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 61,924,031 - 61,976,699 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 54,976,575 - 55,027,638 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 58,426,888 - 58,476,417 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 58,426,894 - 58,476,417 (+) Ensembl panpan1.1 panPan2
STX3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 21 50,298,040 - 50,322,773 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 21 50,298,158 - 50,318,663 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 21 49,740,398 - 49,762,866 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 21 51,472,780 - 51,495,160 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 21 51,472,484 - 51,524,620 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 21 50,518,990 - 50,541,803 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 21 50,618,082 - 50,640,719 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 21 51,243,359 - 51,264,997 (+) NCBI UU_Cfam_GSD_1.0
Stx3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 12,830,408 - 12,863,135 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936581 2,941,953 - 2,971,405 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936581 2,944,230 - 2,976,957 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
STX3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 11,696,913 - 11,740,744 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 11,694,788 - 11,739,858 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 11,061,370 - 11,088,238 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
STX3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 13,866,853 - 13,916,803 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 13,874,526 - 13,916,997 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 111,197,172 - 111,247,259 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Stx3
.
Predicted Target Of
Count of predictions: 757 Count of miRNA genes: 310 Interacting mature miRNAs: 395 Transcripts: ENSRNOT00000028535 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
8693637 Alc29 Alcohol consumption QTL 29 2.7 0.258 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 207987464 234238494 Rat 1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1302787 Stl25 Serum triglyceride level QTL 25 2.7 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 180359209 210702199 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 1600397 Edcs4 Endometrial carcinoma susceptibility QTL 4 2.2 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 1 206081677 251081677 Rat 631838 Niddm36 Non-insulin dependent diabetes mellitus QTL 36 0.01 insulin secretion trait (VT:0003564) calculated pancreatic islet insulin release measurement (CMO:0001217) 1 184550676 229550676 Rat 8693661 Alc34 Alcohol consumption QTL 34 2.2 0.611 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 207987464 228627600 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1300145 Rf7 Renal function QTL 7 2.96 urine creatinine amount (VT:0010540) urine creatinine level (CMO:0000125) 1 185145134 221264292 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 634312 Bp143 Blood pressure QTL 143 3 0.0002 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 182623426 219932796 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 1357399 Bw45 Body weight QTL 45 3.05 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 1 206329708 251329708 Rat 724559 Pancm1 Pancreatic morphology QTL 1 7.1 islet of Langerhans morphology trait (VT:0005215) pancreatic islet damage composite score (CMO:0001156) 1 181759564 214537555 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 1357404 Bw42 Body weight QTL 42 4.49 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 1 206329708 251329708 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 2312564 Glom18 Glomerulus QTL 18 2.4 0.003 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 185356336 231689108 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 2292218 Kidm35 Kidney mass QTL 35 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 199368955 224569684 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 1331790 Bp201 Blood pressure QTL 201 3.127 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 198211513 225126682 Rat 10059587 Bw173 Body weight QTL 173 3.23 0.025 body mass (VT:0001259) body weight (CMO:0000012) 1 202069611 247069611 Rat 61403 Niddm4 Non-insulin dependent diabetes mellitus QTL 4 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 206329708 222745518 Rat 1300168 Bp170 Blood pressure QTL 170 2.76 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 207702246 228581766 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1641926 Teswt2 Testicular weight QTL 2 2.82 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 1 197697768 238755659 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1582206 Kidm33 Kidney mass QTL 33 6.9 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 188377360 224054420 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 634338 Hcar4 Hepatocarcinoma resistance QTL 4 4.6 liver integrity trait (VT:0010547) liver tumorous lesion number to liver area ratio (CMO:0001210) 1 193422268 214537671 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 1600363 Hc6 Hypercalciuria QTL 6 2.7 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 203995416 244113296 Rat 8693618 Alc25 Alcohol consumption QTL 25 3 0.28 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 207987464 228627600 Rat 2293083 Iddm25 Insulin dependent diabetes mellitus QTL 25 4.18 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 181829673 224569684 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat
D1Got205
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 218,074,855 - 218,075,013 (+) Marker Load Pipeline mRatBN7.2 1 208,650,087 - 208,650,245 (+) MAPPER mRatBN7.2 Rnor_6.0 1 228,159,195 - 228,159,348 NCBI Rnor6.0 Rnor_5.0 1 235,227,047 - 235,227,200 UniSTS Rnor5.0 RGSC_v3.4 1 214,561,786 - 214,561,939 RGD RGSC3.4 RGSC_v3.4 1 214,561,787 - 214,561,940 UniSTS RGSC3.4 RGSC_v3.1 1 214,720,216 - 214,720,369 RGD Celera 1 206,121,068 - 206,121,221 UniSTS RH 3.4 Map 1 1502.0 UniSTS RH 3.4 Map 1 1502.0 RGD Cytogenetic Map 1 q43 UniSTS
BE121305
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 208,663,072 - 208,663,246 (+) MAPPER mRatBN7.2 Rnor_6.0 1 228,172,174 - 228,172,347 NCBI Rnor6.0 Rnor_5.0 1 235,240,026 - 235,240,199 UniSTS Rnor5.0 RGSC_v3.4 1 214,574,766 - 214,574,939 UniSTS RGSC3.4 Celera 1 206,134,047 - 206,134,220 UniSTS RH 3.4 Map 1 1502.1 UniSTS Cytogenetic Map 1 q43 UniSTS
RH138992
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 208,641,923 - 208,642,127 (+) MAPPER mRatBN7.2 Rnor_6.0 1 228,151,031 - 228,151,234 NCBI Rnor6.0 Rnor_5.0 1 235,218,883 - 235,219,086 UniSTS Rnor5.0 RGSC_v3.4 1 214,553,622 - 214,553,825 UniSTS RGSC3.4 Celera 1 206,112,909 - 206,113,112 UniSTS RH 3.4 Map 1 1505.9 UniSTS Cytogenetic Map 1 q43 UniSTS
RH139783
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 208,641,269 - 208,641,475 (+) MAPPER mRatBN7.2 Rnor_6.0 1 228,150,377 - 228,150,582 NCBI Rnor6.0 Rnor_5.0 1 235,218,229 - 235,218,434 UniSTS Rnor5.0 RGSC_v3.4 1 214,552,968 - 214,553,173 UniSTS RGSC3.4 Celera 1 206,112,255 - 206,112,460 UniSTS RH 3.4 Map 1 1505.9 UniSTS Cytogenetic Map 1 q43 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
59
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000028535 ⟹ ENSRNOP00000028535
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 208,641,192 - 208,685,781 (-) Ensembl Rnor_6.0 Ensembl 1 228,149,867 - 228,194,977 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000094739 ⟹ ENSRNOP00000092371
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 208,645,167 - 208,667,262 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000102678 ⟹ ENSRNOP00000097210
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 208,641,191 - 208,685,805 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000112820 ⟹ ENSRNOP00000079624
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 208,639,115 - 208,685,805 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000119247 ⟹ ENSRNOP00000078489
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 208,641,192 - 208,685,781 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000120182 ⟹ ENSRNOP00000097922
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 208,639,115 - 208,685,805 (-) Ensembl
RefSeq Acc Id:
NM_031124 ⟹ NP_112386
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 218,067,582 - 218,110,466 (-) NCBI mRatBN7.2 1 208,642,814 - 208,685,700 (-) NCBI Rnor_6.0 1 228,151,921 - 228,194,905 (-) NCBI Rnor_5.0 1 235,205,648 - 235,262,820 (-) NCBI RGSC_v3.4 1 214,554,512 - 214,597,396 (-) RGD Celera 1 206,113,799 - 206,156,646 (-) RGD
Sequence:
CCCGCAGTTGCTCCAGGCCGCTCACTTGGGACGCGCTTACCTGAGACAAGGCGCCTGCCACCCTCACCTGGACCAGGATGAAGGACCGACTGGAGCAGCTGAAGGCCAAGCAGCTGACGCAGGATGAT
hide sequence
RefSeq Acc Id:
XM_006231097 ⟹ XP_006231159
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 218,063,415 - 218,114,865 (-) NCBI mRatBN7.2 1 208,639,534 - 208,686,224 (-) NCBI Rnor_6.0 1 228,147,754 - 228,195,004 (-) NCBI Rnor_5.0 1 235,205,648 - 235,262,820 (-) NCBI
Sequence:
GCGCGCTGAGACCTCTGTGGCCTCGAACGCTCCTCCTCGAGAGCGGCCGCCGCCCGCCTCCGCC
hide sequence
RefSeq Acc Id:
XM_008760262 ⟹ XP_008758484
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 218,069,407 - 218,114,865 (-) NCBI mRatBN7.2 1 208,644,639 - 208,686,240 (-) NCBI Rnor_6.0 1 228,153,646 - 228,195,004 (-) NCBI
Sequence:
GCGCGCTGAGACCTCTGTGGCCTCGAACGCTCCTCCTCGAGAGCGGCCGCCGCCCGCCTCCGCC
hide sequence
RefSeq Acc Id:
XM_008760263 ⟹ XP_008758485
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 218,065,956 - 218,114,865 (-) NCBI mRatBN7.2 1 208,641,188 - 208,686,211 (-) NCBI Rnor_6.0 1 228,150,281 - 228,195,004 (-) NCBI
Sequence:
GCGCGCTGAGACCTCTGTGGCCTCGAACGCTCCTCCTCGAGAGCGGCCGCCGCCCGCCTCCGCCCGTGCTAGCGCTGCTCTCTCGCCCTGGCCGGCACCCCCGCAGTTGCTCCAGGCCGCTCACTTGG
hide sequence
RefSeq Acc Id:
XM_017589775 ⟹ XP_017445264
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 218,063,415 - 218,091,306 (-) NCBI mRatBN7.2 1 208,639,534 - 208,686,237 (-) NCBI Rnor_6.0 1 228,147,754 - 228,195,004 (-) NCBI
Sequence:
GCGCGCTGAGACCTCTGTGGCCTCGAACGCTCCTCCTCGAGAGCGGCCGCCGCCCGCCTCCGCCCGTGCTAGCGCTGCTCTCTCGCCCTGGCCGGCACCCCCGCAGTTGCTCCAGGCCGCTCACTTGG
hide sequence
RefSeq Acc Id:
XM_039092292 ⟹ XP_038948220
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 218,041,791 - 218,114,865 (-) NCBI mRatBN7.2 1 208,617,018 - 208,686,215 (-) NCBI
RefSeq Acc Id:
XM_063275258 ⟹ XP_063131328
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 217,940,697 - 218,114,865 (-) NCBI
RefSeq Acc Id:
XM_063275266 ⟹ XP_063131336
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 218,065,956 - 218,114,865 (-) NCBI
RefSeq Acc Id:
XM_063275275 ⟹ XP_063131345
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 217,963,568 - 218,114,865 (-) NCBI
RefSeq Acc Id:
XR_005492999
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 218,041,791 - 218,114,865 (-) NCBI mRatBN7.2 1 208,617,018 - 208,686,209 (-) NCBI
RefSeq Acc Id:
XR_010058289
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 217,963,567 - 218,114,865 (-) NCBI
RefSeq Acc Id:
XR_010058290
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 217,963,567 - 218,114,865 (-) NCBI
RefSeq Acc Id:
NP_112386 ⟸ NM_031124
- UniProtKB:
Q08849 (UniProtKB/Swiss-Prot), B4F7E6 (UniProtKB/TrEMBL), A0A8I5ZL11 (UniProtKB/TrEMBL)
- Sequence:
MKDRLEQLKAKQLTQDDDTDEVEIAIDNTAFMDEFFSEIEETRLNIDKISEHVEEAKKLYSIILSAPIPEPKTKDDLEQLTTEIKKRANNVRNKLKSMEKHIEEDEVRSSADLRIRKSQHSVLSRKFV
hide sequence
RefSeq Acc Id:
XP_006231159 ⟸ XM_006231097
- Peptide Label:
isoform X5
- UniProtKB:
A0A8I5ZRD1 (UniProtKB/TrEMBL), A6I0B2 (UniProtKB/TrEMBL), A6I0B3 (UniProtKB/TrEMBL)
- Sequence:
MKDRLEQLKAKQLTQDDDTDEVEIAIDNTAFMDEFFSEIEETRLNIDKISEHVEEAKKLYSIIL
hide sequence
RefSeq Acc Id:
XP_008758485 ⟸ XM_008760263
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6AS91 (UniProtKB/TrEMBL), A0A8I6AGY3 (UniProtKB/TrEMBL)
- Sequence:
MKDRLEQLKAKQLTQDDDTDEVEIAIDNTAFMDEFFSEIEETRLNIDKISEHVEEAKKLYSIILSAPIPEPKTKDDLEQLTTEIKKRANNVRNKLKSMEKHIEEDEVRSSADLRIRKSQHSVLSRKFV
hide sequence
RefSeq Acc Id:
XP_008758484 ⟸ XM_008760262
- Peptide Label:
isoform X2
- Sequence:
MKDRLEQLKAKQLTQDDDTDEVEIAIDNTAFMDEFFSEIEETRLNIDKISEHVEEAKKLYSIILSAPIPEPKTKDDLEQLTTEIKKRANNVRNKLKSMEKHIEEDEVRSSADLRIRKSQHSVLSRKFV
hide sequence
RefSeq Acc Id:
XP_017445264 ⟸ XM_017589775
- Peptide Label:
isoform X6
- UniProtKB:
A6I0B5 (UniProtKB/TrEMBL)
- Sequence:
MMTRTRLRLLLIIQRSWMSSFLRLRKRGSTSTRSQSMWRKLRNSTVSFSLHRFQSQNFHGILSYLLRLSSHETKDDLEQLTTEIKKRANNVRNKLKSMEKHIEEDEVRSSADLRIRKSQHSVLSRKFV
hide sequence
Ensembl Acc Id:
ENSRNOP00000028535 ⟸ ENSRNOT00000028535
RefSeq Acc Id:
XP_038948220 ⟸ XM_039092292
- Peptide Label:
isoform X7
Ensembl Acc Id:
ENSRNOP00000079624 ⟸ ENSRNOT00000112820
Ensembl Acc Id:
ENSRNOP00000078489 ⟸ ENSRNOT00000119247
Ensembl Acc Id:
ENSRNOP00000097210 ⟸ ENSRNOT00000102678
Ensembl Acc Id:
ENSRNOP00000092371 ⟸ ENSRNOT00000094739
Ensembl Acc Id:
ENSRNOP00000097922 ⟸ ENSRNOT00000120182
RefSeq Acc Id:
XP_063131328 ⟸ XM_063275258
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063131345 ⟸ XM_063275275
- Peptide Label:
isoform X8
RefSeq Acc Id:
XP_063131336 ⟸ XM_063275266
- Peptide Label:
isoform X4
- UniProtKB:
Q08849 (UniProtKB/Swiss-Prot), B4F7E6 (UniProtKB/TrEMBL), A0A8I5ZL11 (UniProtKB/TrEMBL)
RGD ID: 13690795 Promoter ID: EPDNEW_R1319 Type: initiation region Name: Stx3_1 Description: syntaxin 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 228,194,960 - 228,195,020 EPDNEW
BIND 130902
130912
133977
134467
134476
134480
BioCyc Gene G2FUF-56352 BioCyc
Ensembl Genes ENSRNOG00000021013 Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript ENSRNOT00000028498 ENTREZGENE
ENSRNOT00000028535.6 UniProtKB/Swiss-Prot
ENSRNOT00000094739 ENTREZGENE
ENSRNOT00000102678 ENTREZGENE
ENSRNOT00000112820 ENTREZGENE
ENSRNOT00000142473 ENTREZGENE
Gene3D-CATH 1.20.5.110 UniProtKB/Swiss-Prot
1.20.58.70 UniProtKB/Swiss-Prot
InterPro SNARE UniProtKB/Swiss-Prot
Stx3 UniProtKB/Swiss-Prot
Syntaxin UniProtKB/Swiss-Prot
Syntaxin/epimorphin_CS UniProtKB/Swiss-Prot
Syntaxin_N UniProtKB/Swiss-Prot
T_SNARE_dom UniProtKB/Swiss-Prot
KEGG Report rno:81802 UniProtKB/Swiss-Prot
NCBI Gene 81802 ENTREZGENE
PANTHER PTHR19957 UniProtKB/Swiss-Prot
PTHR19957:SF34 UniProtKB/Swiss-Prot
Pfam SNARE UniProtKB/Swiss-Prot
Syntaxin UniProtKB/Swiss-Prot
PhenoGen Stx3 PhenoGen
PROSITE SYNTAXIN UniProtKB/Swiss-Prot
T_SNARE UniProtKB/Swiss-Prot
RatGTEx ENSRNOG00000021013 RatGTEx
SMART SynN UniProtKB/Swiss-Prot
t_SNARE UniProtKB/Swiss-Prot
Superfamily-SCOP SSF47661 UniProtKB/Swiss-Prot
UniProt A0A8I5ZL11 ENTREZGENE, UniProtKB/TrEMBL
A0A8I5ZRD1 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6AGY3 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6AS91 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6GMR2_RAT UniProtKB/TrEMBL
A6I0B2 ENTREZGENE, UniProtKB/TrEMBL
A6I0B3 ENTREZGENE, UniProtKB/TrEMBL
A6I0B5 ENTREZGENE, UniProtKB/TrEMBL
A6I0B6_RAT UniProtKB/TrEMBL
B4F7E6 ENTREZGENE, UniProtKB/TrEMBL
Q08849 ENTREZGENE, UniProtKB/Swiss-Prot
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-12-14
Stx3
syntaxin 3
Stx3a
Symbol updated
1299863 APPROVED
2002-08-07
Stx3a
syntaxin 3
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_domains
C-terminal hydrophobic domain anchors protein on the cytoplasmic side of the membrane
68313
gene_expression
protein expressed in neuronal cell types throughout kidney
730051
gene_process
important for calcium-dependent exocytosis
68313
gene_protein
protein weighs 37 kDa
730051
