Rabac1 (Rab acceptor 1) - Rat Genome Database

Name: Rabac1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Rabac1 (Rab acceptor 1) Rattus norvegicus

Analyze

Symbol:

Rabac1

Name:

Rab acceptor 1

RGD ID:

621002

Description:

Enables GTPase binding activity and proline-rich region binding activity. Is active in synapse. Orthologous to human RABAC1 (Rab acceptor 1); INTERACTS WITH 1,2,4-trimethylbenzene; 2,3,7,8-tetrachlorodibenzodioxine; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

MGC105390; Pra1; PRA1 family protein 1; prenylated Rab acceptor protein 1; Rab acceptor 1 (prenylated)

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RABAC1 (Rab acceptor 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rabac1 (Rab acceptor 1 (prenylated))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rabac1 (Rab acceptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RABAC1 (Rab acceptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RABAC1 (Rab acceptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rabac1 (Rab acceptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RABAC1 (Rab acceptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RABAC1 (Rab acceptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rabac1 (Rab acceptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CTNS (cystinosin, lysosomal cystine transporter)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Rabac1 (Rab acceptor 1 (prenylated))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	RABAC1 (Rab acceptor 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rabac1 (Rab acceptor 1 (prenylated))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG1418	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	YIP3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	rabac1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	89,691,884 - 89,695,017 (-)	NCBI		GRCr8
mRatBN7.2	1	80,564,029 - 80,567,164 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	80,564,033 - 80,567,163 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	85,956,606 - 85,959,730 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	94,507,466 - 94,510,591 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	87,712,364 - 87,715,488 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	81,843,667 - 81,846,765 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	81,843,649 - 81,846,804 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	83,095,963 - 83,099,061 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	80,271,951 - 80,275,050 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	80,350,061 - 80,353,161 (-)	NCBI
Celera	1	75,010,090 - 75,013,188 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Carpenter Syndrome 2 (ISO)

congenital hypoplastic anemia (ISO)

craniosynostosis (ISO)

Diamond-Blackfan anemia (ISO)

genetic disease (ISO)

maple syrup urine disease (ISO)

schizophrenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trimethylbenzene (EXP)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

buspirone (EXP)

carbon nanotube (ISO)

CGP 52608 (ISO)

chrysene (ISO)

clofibrate (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

folic acid (ISO)

gentamycin (EXP)

glafenine (EXP)

methylseleninic acid (ISO)

nimesulide (EXP)

paracetamol (ISO)

perfluorooctanoic acid (EXP,ISO)

quercetin (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

selenium atom (ISO)

tetrachloroethene (ISO)

tetrachloromethane (ISO)

thapsigargin (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

triptonide (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vitamin E (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

vesicle-mediated transport (NAS)

Cellular Component

endoplasmic reticulum (IEA)

Golgi apparatus (IBA,ISO)

membrane (ISO)

plasma membrane (IEA)

synapse (IDA,IEP)

synaptic vesicle (IEA)

Molecular Function

GTPase binding (IPI)

identical protein binding (ISO)

proline-rich region binding (IPI)

protein binding (ISO)

protein-macromolecule adaptor activity (NAS)

References

References - curated

#	Reference Title	Reference Citation
1.	Piccolo, a presynaptic zinc finger protein structurally related to bassoon.	Fenster SD, etal., Neuron 2000 Jan;25(1):203-14.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Isolation and characterization of a dual prenylated Rab and VAMP2 receptor.	Martincic I, etal., J Biol Chem 1997 Oct 24;272(43):26991-8.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10751420	PMID:10964695	PMID:11096102	PMID:11535589	PMID:12107180	PMID:12477932	PMID:15489334	PMID:16169070	PMID:16189514	PMID:19060904	PMID:19946888	PMID:21900206
PMID:25416956

Genomics

Comparative Map Data

Rabac1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	89,691,884 - 89,695,017 (-)	NCBI		GRCr8
mRatBN7.2	1	80,564,029 - 80,567,164 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	80,564,033 - 80,567,163 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	85,956,606 - 85,959,730 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	94,507,466 - 94,510,591 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	87,712,364 - 87,715,488 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	81,843,667 - 81,846,765 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	81,843,649 - 81,846,804 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	83,095,963 - 83,099,061 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	80,271,951 - 80,275,050 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	80,350,061 - 80,353,161 (-)	NCBI
Celera	1	75,010,090 - 75,013,188 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

RABAC1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	41,956,683 - 41,959,321 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	41,956,681 - 41,959,321 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	42,460,835 - 42,463,473 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	47,152,675 - 47,157,340 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	47,152,677 - 47,155,311	NCBI
Celera	19	39,260,462 - 39,263,157 (-)	NCBI		Celera
Cytogenetic Map	19	q13.2	NCBI
HuRef	19	38,891,985 - 38,894,680 (-)	NCBI		HuRef
CHM1_1	19	42,462,485 - 42,465,180 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	44,776,066 - 44,778,704 (-)	NCBI		T2T-CHM13v2.0

Rabac1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	24,669,175 - 24,672,153 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	24,669,177 - 24,672,179 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	24,969,750 - 24,972,728 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	24,969,752 - 24,972,754 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	25,754,769 - 25,757,747 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	24,678,510 - 24,681,416 (-)	NCBI		MGSCv36	mm8
Celera	7	19,585,558 - 19,588,535 (-)	NCBI		Celera
Cytogenetic Map	7	A3	NCBI
cM Map	7	13.73	NCBI

Rabac1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955555	897,846 - 902,636 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955555	897,927 - 900,406 (+)	NCBI	ChiLan1.0	ChiLan1.0

RABAC1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	48,061,783 - 48,064,596 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	49,930,157 - 49,932,905 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	38,844,358 - 38,847,068 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	47,348,367 - 47,351,067 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	47,348,367 - 47,351,058 (-)	Ensembl	panpan1.1		panPan2

RABAC1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	112,351,416 - 112,354,010 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	112,351,388 - 112,354,045 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	111,783,468 - 111,786,062 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	112,971,019 - 112,973,613 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	112,970,991 - 112,973,648 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	112,524,256 - 112,526,842 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	112,160,657 - 112,163,252 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	113,086,869 - 113,089,455 (+)	NCBI		UU_Cfam_GSD_1.0

Rabac1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	16,150,924 - 16,153,502 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936706	497,963 - 500,842 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936706	498,271 - 500,847 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RABAC1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	49,933,434 - 49,936,372 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	49,933,439 - 49,936,376 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	45,951,837 - 45,954,761 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RABAC1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	36,157,809 - 36,160,505 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	36,156,902 - 36,161,067 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666073	14,400,042 - 14,402,756 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rabac1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624907	742,062 - 744,666 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624907	742,038 - 744,850 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rabac1
18 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	114
Count of miRNA genes:	90
Interacting mature miRNAs:	91
Transcripts:	ENSRNOT00000027435
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	49361465	82174945	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	53895117	82174945	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	53895117	82174945	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	72197680	90508767	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	77494165	122494165	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	77857876	122857876	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	77876254	106047988	Rat
61344	Bp29	Blood pressure QTL 29	7.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	78350581	123350581	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	78430536	123430536	Rat
61433	Cia2	Collagen induced arthritis QTL 2	5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	78430754	91209302	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	78479925	123479925	Rat

Markers in Region

RH134518

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	80,564,090 - 80,564,296 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	81,843,726 - 81,843,931	NCBI	Rnor6.0
Rnor_5.0	1	83,096,022 - 83,096,227	UniSTS	Rnor5.0
RGSC_v3.4	1	80,272,010 - 80,272,215	UniSTS	RGSC3.4
Celera	1	75,010,149 - 75,010,354	UniSTS
RH 3.4 Map	1	824.8	UniSTS
Cytogenetic Map	1	q21	UniSTS

AU047794

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	80,563,753 - 80,564,019 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	81,843,389 - 81,843,654	NCBI	Rnor6.0
Rnor_5.0	1	83,095,685 - 83,095,950	UniSTS	Rnor5.0
RGSC_v3.4	1	80,271,673 - 80,271,938	UniSTS	RGSC3.4
Celera	1	75,009,814 - 75,010,077	UniSTS
Cytogenetic Map	1	q21	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031774	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC114696	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF025506	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC086387	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210487	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MW396296	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000027435 ⟹ ENSRNOP00000027435

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	80,564,033 - 80,567,163 (-)	Ensembl
Rnor_6.0 Ensembl	1	81,843,649 - 81,846,804 (-)	Ensembl

RefSeq Acc Id:

NM_031774 ⟹ NP_113962

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	89,691,884 - 89,695,017 (-)	NCBI
mRatBN7.2	1	80,564,029 - 80,567,164 (-)	NCBI
Rnor_6.0	1	81,843,667 - 81,846,765 (-)	NCBI
Rnor_5.0	1	83,095,963 - 83,099,061 (-)	NCBI
RGSC_v3.4	1	80,271,951 - 80,275,050 (-)	RGD
Celera	1	75,010,090 - 75,013,188 (-)	RGD

Sequence:

show sequence

GAATTCGGCACGAGCGCGCTCGGGTGGGGCCGCCTAGGTGCTGCTGGGCTCGGGGATATTTACA
GCGGTTCTATTCACTGCAGCGCGAACATGGCGGCCCAGAAGGACCAGCAGAAGGATGCCGAAGT
GGAAGGGCTGAGCGCCACGACCCTGCTACCCAAGCTGATTCCCTCTGGCGCAGGTCGAGAGTGG
CTGGAGCGGCGCCGTGCTACCATCCGGCCCTGGGGCACCTTCGTGGACCAGCAACGTTTCTCGC
GACCCCGCAACGTAGGCGAGCTTTGCCAGCGCCTGGTTCGCAACGTGGAGTATTATCAAAGCAA
CTACGTGTTTGTGTTTCTGGGCCTCATCCTGTACTGCGTGGTGACATCCCCCATGCTGCTGGTG
GCTCTGGCTGTCTTCTTTGGCGCCTGTTACATTCTCTATCTGCGCACGTTGCAGTCTAAGCTTG
TGCTCTTTGGCCGTGAGGTGAGCCCAGCACATCAGTACGCCCTGGCTGGTGGTGTCTCTTTCCC
TTTCTTCTGGCTGGCCGGTGCTGGCTCCGCTGTCTTCTGGGTCCTGGGAGCCACCCTGGTACTT
ATAGGCTCTCACGCTGCCTTCCACCAGATAGAGCCTGCAGATGGTGAGGAACTGCAGATGGAAC
CTGTGTAAAGTGTCCTCCAGGACCTGCCAGCCTCTCCTGCCGGCCTCTCCTGCCCGTGGCTGTC
CCCTCTCTGTCTGTTCTTGCCCTACCTGACCTAGACACTCAGCTCAACTCAGAGCCTAACTCTG
AGCCTTCCACCCTAGACCTCAAACCCGGGGAGAGGCTTTTATCTTCGGAAATAAAACAGTTACA
ATTGAAAAAAAAAAAAAAAAAAACTCGAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_113962	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB81721	(Get FASTA)	NCBI Sequence Viewer
	AAH86387	(Get FASTA)	NCBI Sequence Viewer
	EDM08052	(Get FASTA)	NCBI Sequence Viewer
	EDM08053	(Get FASTA)	NCBI Sequence Viewer
	EDM08054	(Get FASTA)	NCBI Sequence Viewer
	EDM08055	(Get FASTA)	NCBI Sequence Viewer
	EDM08056	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000027435
	ENSRNOP00000027435.1
	ENSRNOP00055047300
	ENSRNOP00060042465
	ENSRNOP00065044763
GenBank Protein	O35394	(Get FASTA)	NCBI Sequence Viewer
	QST78326	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_113962 ⟸ NM_031774
- UniProtKB:	O35394 (UniProtKB/Swiss-Prot), A6J929 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAAQKDQQKDAEVEGLSATTLLPKLIPSGAGREWLERRRATIRPWGTFVDQQRFSRPRNVGELC QRLVRNVEYYQSNYVFVFLGLILYCVVTSPMLLVALAVFFGACYILYLRTLQSKLVLFGREVSP AHQYALAGGVSFPFFWLAGAGSAVFWVLGATLVLIGSHAAFHQIEPADGEELQMEPV hide sequence

RefSeq Acc Id:

ENSRNOP00000027435 ⟸ ENSRNOT00000027435

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O35394-F1-model_v2	AlphaFold	O35394	1-185	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689808

Promoter ID:

EPDNEW_R333

Type:

initiation region

Name:

Rabac1_1

Description:

Rab acceptor 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	81,846,784 - 81,846,844	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621002	AgrOrtholog
BioCyc Gene	G2FUF-60408	BioCyc
Ensembl Genes	ENSRNOG00000020233	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00055033184	UniProtKB/Swiss-Prot
	ENSRNOG00060029402	UniProtKB/Swiss-Prot
	ENSRNOG00065031562	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000027435	ENTREZGENE
	ENSRNOT00000027435.5	UniProtKB/Swiss-Prot
	ENSRNOT00055057365	UniProtKB/Swiss-Prot
	ENSRNOT00060051045	UniProtKB/Swiss-Prot
	ENSRNOT00065054396	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7302383	IMAGE-MGC_LOAD
InterPro	Prenylated_rab_accept_PRA1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:83583	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:105390	IMAGE-MGC_LOAD
NCBI Gene	83583	ENTREZGENE
PANTHER	PRENYLATED RAB ACCEPTOR 1-RELATED	UniProtKB/TrEMBL
	PRENYLATED RAB ACCEPTOR PROTEIN 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR19317	UniProtKB/Swiss-Prot
Pfam	PRA1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Rabac1	PhenoGen
RatGTEx	ENSRNOG00000020233	RatGTEx
	ENSRNOG00055033184	RatGTEx
	ENSRNOG00060029402	RatGTEx
	ENSRNOG00065031562	RatGTEx
UniProt	A0A8A1UFL1_RAT	UniProtKB/TrEMBL
	A6J928_RAT	UniProtKB/TrEMBL
	A6J929	ENTREZGENE, UniProtKB/TrEMBL
	A6J931_RAT	UniProtKB/TrEMBL
	A6J932_RAT	UniProtKB/TrEMBL
	O35394	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-22	Rabac1	Rab acceptor 1	Rabac1	Rab acceptor 1 (prenylated)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-02-26	Rabac1	Rab acceptor 1 (prenylated)		rab acceptor 1 (prenylated)	Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Rabac1	rab acceptor 1 (prenylated)			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	broadly expressed in all tissues	633794

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar