Advanced Search (OLGA)

Gene: Abat (4-aminobutyrate aminotransferase) Rattus norvegicus

Analyze

Symbol:

Abat

Name:

4-aminobutyrate aminotransferase

RGD ID:

620948

Description:

Enables (S)-3-amino-2-methylpropionate transaminase activity and 4-aminobutyrate:2-oxoglutarate transaminase activity. Involved in several processes, including gamma-aminobutyric acid biosynthetic process; positive regulation of inhibitory postsynaptic potential; and regulation of secretion. Located in mitochondrial matrix. Used to study several diseases, including Huntington's disease; depressive disorder; epilepsy (multiple); heroin dependence; and ischemia. Biomarker of Parkinsonism. Human ortholog(s) of this gene implicated in Alzheimer's disease; GABA aminotransferase deficiency; and Huntington's disease. Orthologous to human ABAT (4-aminobutyrate aminotransferase); PARTICIPATES IN 2-hydroxyglutaric aciduria pathway; 3-hydroxy-3-methylglutaryl-CoA lyase deficiency pathway; 3-hydroxyisobutyric aciduria pathway; INTERACTS WITH (+)-schisandrin B; (aminooxy)acetic acid; 1,3-dinitrobenzene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

(S)-3-amino-2-methylpropionate transaminase; 4-aminobutyrate aminotransferase, mitochondrial; beta-AlaAT; beta-AlaAT I; GABA aminotransferase; GABA transaminase; GABA-AT; GABA-T; Gabat; gamma-amino-N-butyrate transaminase; L-AIBAT; MGC93392

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ABAT (4-aminobutyrate aminotransferase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Abat (4-aminobutyrate aminotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Abat (4-aminobutyrate aminotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ABAT (4-aminobutyrate aminotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ABAT (4-aminobutyrate aminotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Abat (4-aminobutyrate aminotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ABAT (4-aminobutyrate aminotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ABAT (4-aminobutyrate aminotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Abat (4-aminobutyrate aminotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Abat (4-aminobutyrate aminotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ATP10B (ATPase phospholipid transporting 10B (putative))	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	ABAT (4-aminobutyrate aminotransferase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Abat (4-aminobutyrate aminotransferase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	abat (4-aminobutyrate aminotransferase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Gabat	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	UGA1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	gta-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	abat	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	abat	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Allele / Splice:

Abat^{Tn(sb-T2/Bart3)2.163Mcwi}

Genetic Models:

F344-Abat^{Tn(sb-T2/Bart3)2.163Mcwi}

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	7,503,351 - 7,599,474 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	7,492,022 - 7,599,474 (-)	Ensembl				GRCr8
mRatBN7.2	10	6,996,688 - 7,092,835 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	6,999,819 - 7,092,835 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	11,705,905 - 11,800,150 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	11,202,332 - 11,296,694 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	6,853,860 - 6,945,716 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	7,093,406 - 7,200,439 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	7,093,405 - 7,200,499 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	5,894,187 - 6,002,068 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	7,040,725 - 7,137,154 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	5,995,207 - 6,088,218 (-)	NCBI		Celera
RGSC_v3.1	10	7,040,724 - 7,137,154 (-)	NCBI
Cytogenetic Map	10	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Abnormal Reflexes (ISO)

Alzheimer's disease (ISO)

Anorexia (IMP)

autistic disorder (ISO)

Cocaine-Related Disorders (IMP)

depressive disorder (IMP)

Drug-Induced Dyskinesia (IMP)

epilepsy (IDA,IMP)

Experimental Diabetes Mellitus (IDA)

Experimental Liver Cirrhosis (ISO)

GABA aminotransferase deficiency (ISO)

gastroesophageal reflux disease (ISO)

genetic disease (ISO)

Genetic Predisposition to Disease (ISO)

heroin dependence (IMP)

Huntington's disease (IMP,ISO)

Hyperalgesia (IMP)

hypertension (IDA)

ischemia (IDA)

Lethargy (ISO)

Muscle Hypotonia (ISO)

Parkinsonism (IEP)

Psychomotor Disorders (ISO)

reflex epilepsy (IDA)

retinal disease (ISO)

status epilepticus (IDA)

Tinnitus (IMP)

West syndrome (IMP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

(aminooxy)acetic acid (EXP)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

1,3-dinitrobenzene (EXP)

1-bromopropane (EXP)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

2,4-dinitrotoluene (EXP)

2-amino-14,16-dimethyloctadecan-3-ol (ISO)

2-aminoethyl hydrogen sulfate (EXP)

3,4-methylenedioxymethamphetamine (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-diaminodiphenylmethane (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

afimoxifene (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

amitriptyline (EXP)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arsenous acid (ISO)

Azoxymethane (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

beta-lapachone (ISO)

beta-naphthoflavone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (EXP)

Bisphenol B (ISO)

bisphenol F (ISO)

Brodifacoum (EXP)

butanal (ISO)

Butylparaben (EXP)

cadmium atom (ISO)

cadmium dichloride (EXP)

caffeine (ISO)

calcitriol (ISO)

carbon nanotube (ISO)

carnosic acid (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

choline (ISO)

cisplatin (ISO)

clofibrate (EXP)

cocaine (ISO)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

cypermethrin (ISO)

decabromodiphenyl ether (ISO)

deoxynivalenol (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (ISO)

dimethyl sulfoxide (ISO)

disulfiram (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

drometrizole (ISO)

endosulfan (EXP)

entinostat (ISO)

enzacamene (EXP)

ethanol (EXP,ISO)

finasteride (EXP)

folic acid (ISO)

fulvestrant (ISO)

furan (EXP)

gamma-aminobutyric acid (EXP,ISO)

genistein (ISO)

gentamycin (EXP)

glafenine (EXP)

glyphosate (ISO)

GSK-J4 (ISO)

indometacin (EXP)

ivermectin (ISO)

ketoconazole (EXP)

L-methionine (ISO)

leflunomide (ISO)

lithium chloride (ISO)

maneb (ISO)

methapyrilene (EXP,ISO)

N-nitrosodimethylamine (EXP)

N-Nitrosopyrrolidine (ISO)

nefazodone (EXP)

nimesulide (EXP)

O-methyleugenol (ISO)

ochratoxin A (EXP)

okadaic acid (ISO)

ozone (ISO)

panobinostat (ISO)

paracetamol (EXP,ISO)

paraquat (ISO)

pentanal (ISO)

pentetrazol (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP,ISO)

permethrin (EXP)

phenylmercury acetate (ISO)

phlorizin (ISO)

pioglitazone (ISO)

pirinixic acid (EXP,ISO)

poly(I:C) (ISO)

potassium dichromate (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

progesterone (ISO)

propanal (ISO)

rotenone (EXP)

SB 431542 (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (EXP,ISO)

sodium dichromate (EXP)

sunitinib (ISO)

Tesaglitazar (EXP)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

triptonide (ISO)

troglitazone (EXP)

valproic acid (ISO)

vancomycin (ISO)

vigabatrin (EXP,ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cerebellum development (IEP)

copulation (IMP)

exploration behavior (IMP)

gamma-aminobutyric acid biosynthetic process (IMP)

gamma-aminobutyric acid catabolic process (IBA,IC,IEA,ISO)

gamma-aminobutyric acid metabolic process (IEA,ISO)

locomotory behavior (IMP)

negative regulation of blood pressure (IMP)

negative regulation of dopamine secretion (IMP)

negative regulation of gamma-aminobutyric acid secretion (IMP)

nervous system process (IEA,ISO,ISS)

positive regulation of aspartate secretion (IMP)

positive regulation of dopamine metabolic process (IMP)

positive regulation of heat generation (IMP)

positive regulation of inhibitory postsynaptic potential (IMP)

positive regulation of insulin secretion (IMP)

positive regulation of prolactin secretion (IMP)

positive regulation of uterine smooth muscle contraction (IMP)

response to cocaine (IMP)

response to ethanol (IDA)

response to hypoxia (IMP)

response to iron ion (IDA)

response to nicotine (IMP)

response to xenobiotic stimulus (IDA)

Cellular Component

4-aminobutyrate transaminase complex (IEA,ISO,ISS)

mitochondrial matrix (IDA,IEA)

mitochondrion (IBA,IEA,ISO,ISS)

Molecular Function

(S)-3-amino-2-methylpropionate transaminase activity (IDA,IEA)

4-aminobutyrate:2-oxoglutarate transaminase activity (IDA,IEA,ISO,ISS)

identical protein binding (IEA,ISO,ISS)

iron-sulfur cluster binding (IEA)

metal ion binding (IEA)

protein homodimerization activity (ISO)

pyridoxal phosphate binding (IBA,IEA,ISO,ISS)

succinate-semialdehyde dehydrogenase binding (ISO,ISS)

transaminase activity (IEA)

transferase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

2-hydroxyglutaric aciduria pathway (ISO)

3-hydroxy-3-methylglutaryl-CoA lyase deficiency pathway (ISO)

3-hydroxyisobutyric aciduria pathway (ISO)

3-methylcrotonyl CoA carboxylase 1 deficiency pathway (ISO)

3-methylglutaconic aciduria type 1 pathway (ISO)

3-methylglutaconic aciduria type 3 pathway (ISO)

alanine, aspartate and glutamate metabolic pathway (IEA)

beta-alanine metabolic pathway (IEA,ISO)

butanoate metabolic pathway (IEA)

Canavan disease pathway (ISO)

carnosinemia pathway (ISO)

GABA aminotransferase deficiency pathway (ISO)

glutamic acid/glutamate metabolic pathway (ISO)

homocarnosinosis pathway (ISO)

isobutyryl-CoA dehydrogenase deficiency pathway (ISO)

isovaleric acidemia pathway (ISO)

malonic aciduria pathway (ISO)

maple syrup urine disease pathway (ISO)

methylmalonate semialdehyde dehydrogenase deficiency pathway (ISO)

methylmalonic acidemia pathway (ISO)

methylmalonic aciduria, cobalamin-related pathway (ISO)

propanoate metabolic pathway (IEA,ISO)

propionic acidemia pathway (ISO)

succinic semialdehyde dehydrogenase deficiency pathway (ISO)

valine, leucine and isoleucine degradation pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	CPP-115, a vigabatrin analogue, decreases spasms in the multiple-hit rat model of infantile spasms.	Briggs SW, etal., Epilepsia. 2014 Jan;55(1):94-102. doi: 10.1111/epi.12424. Epub 2013 Oct 28.
2.	Vigabatrin, a GABA transaminase inhibitor, reversibly eliminates tinnitus in an animal model.	Brozoski TJ, etal., J Assoc Res Otolaryngol. 2007 Mar;8(1):105-18. Epub 2007 Jan 13.
3.	Reduced GABA transaminase activity in the Huntington's disease putamen.	Carter CJ Neurosci Lett. 1984 Aug 10;48(3):339-42.
4.	Anorectic potency of inhibiting GABA transaminase in brain: studies of hypothalamic, dietary and genetic obesities.	Coscina DV and Nobrega JN, Int J Obes. 1984;8 Suppl 1:191-200.
5.	A pharmacologic strategy for the treatment of nicotine addiction.	Dewey SL, etal., Synapse. 1999 Jan;31(1):76-86.
6.	Mechanism of GABA involvement in post-traumatic trigeminal neuropathic pain: Activation of neuronal circuitry composed of PKCgamma interneurons and pERK1/2 expressing neurons.	Dieb W and Hafidi A, Eur J Pain. 2014 May 28. doi: 10.1002/ejp.525.
7.	Effect of GABA-T inhibitors on prolactin secretion in vitro.	Duvilanski BH, etal., Eur J Pharmacol. 1985 Sep 10;115(1):65-9.
8.	Behavioral effects of vigabatrin correlated with whole brain gamma-aminobutyric acid metabolism in audiogenic sensitive rats.	Engelborghs S, etal., Arzneimittelforschung. 1998 Jul;48(7):713-6.
9.	Gamma-vinyl GABA, an irreversible inhibitor of GABA transaminase, alters the acquisition and expression of cocaine-induced sensitization in male rats.	Gardner EL, etal., Synapse. 2002 Dec 15;46(4):240-50.
10.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
11.	GABAergic blockade of cocaine-associated cue-induced increases in nucleus accumbens dopamine.	Gerasimov MR, etal., Eur J Pharmacol. 2001 Mar 2;414(2-3):205-9.
12.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
13.	Hypercholesterolemia in rats with hepatomas: increased oxysterols accelerate efflux but do not inhibit biosynthesis of cholesterol.	Hirayama T, etal., Hepatology. 2006 Sep;44(3):602-11.
14.	Alteration of the GABAergic neuronal system of the retina and superior colliculus in streptozotocin-induced diabetic rat.	Honda M, etal., Kobe J Med Sci. 1998 Feb;44(1):1-8.
15.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
16.	Changes of GABA metabolic enzymes in acute retinal ischemia.	Kobayashi N, etal., Exp Eye Res. 1999 Jul;69(1):91-6.
17.	The mature size of rat 4-aminobutyrate aminotransferase is different in liver and brain.	Kontani Y, etal., Eur J Biochem 1999 Aug;264(1):218-22.
18.	Inhibition of gamma-aminobutyric acid aminotransferase from rat brain mitochondria by chloride and acetate.	Kraus P and Noack G, J Enzyme Inhib. 1996;10(2):125-33.
19.	Electrical stimulation-evoked release of endogenous aspartate from rat medulla oblongata slices. Effects of inhibitors of aspartate aminotransferase and GABA transaminase.	Kubo T, etal., Naunyn Schmiedebergs Arch Pharmacol. 1990 Mar;341(3):221-4.
20.	Effects of iron deficiency on iron distribution and gamma-aminobutyric acid (GABA) metabolism in young rat brain tissues.	Li D Hokkaido Igaku Zasshi. 1998 May;73(3):215-25.
21.	In vivo administration of valproate reduces the nerve terminal (synaptosomal) activity of GABA aminotransferase in discrete brain areas of rats.	Loscher W Neurosci Lett. 1993 Oct 1;160(2):177-80.
22.	Glutamate dependence of GABA levels in neurons of hypoxic and hypoglycemic rat hippocampal slices.	Madl JE and Royer SM, Neuroscience. 2000;96(4):657-64.
23.	Histochemical study of glutamic dehydrogenase (GLD) and GABA-transaminase (GABA-T) activities in the rat cerebellum during postnatal development.	Martinez-Rodriguez R, etal., Cell Mol Biol. 1982;28(6):513-20.
24.	Chronic administration of the antidepressant phenelzine and its N-acetyl analogue: effects on GABAergic function.	McKenna KF, etal., J Neural Transm Suppl. 1994;41:115-22.
25.	Vigabatrin versus carbamazepine and phenytoin in kainic acid-treated pubescent rats.	Mecarelli O, etal., Pharmacol Res. 1997 Aug;36(2):87-93.
26.	A rat brain cDNA encodes enzymatically active GABA transaminase and provides a molecular probe for GABA-catabolizing cells.	Medina-Kauwe LK, etal., J Neurochem 1994 Apr;62(4):1267-75.
27.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
28.	Identification of a median thalamic system regulating seizures and arousal.	Miller JW, etal., Epilepsia. 1989 Jul-Aug;30(4):493-500.
29.	Anticonvulsant activity of Benkara malabarica (Linn.) root extract: In vitro and in vivo investigation.	Mishra N, etal., J Ethnopharmacol. 2010 Mar 24;128(2):533-6. doi: 10.1016/j.jep.2010.01.042. Epub 2010 Jan 28.
30.	Glutamate decarboxylase and GABA aminotransferase levels in different regions of rat brain on the onset of Leptazol induced convulsions.	Nasreen Z, etal., Neurochem Res. 2012 Jan;37(1):202-4. doi: 10.1007/s11064-011-0603-2. Epub 2011 Sep 21.
31.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
32.	Effects of GABA-transaminase inhibitor Vigabatrin on thermoregulation in rats.	Nikolov RP and Yakimova KS, Amino Acids. 2011 May;40(5):1441-5. doi: 10.1007/s00726-010-0754-5. Epub 2010 Sep 28.
33.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
34.	Paradoxical reduction of synaptic inhibition by vigabatrin.	Overstreet LS and Westbrook GL, J Neurophysiol. 2001 Aug;86(2):596-603.
35.	(1S, 3S)-3-amino-4-difluoromethylenyl-1-cyclopentanoic acid (CPP-115), a potent gamma-aminobutyric acid aminotransferase inactivator for the treatment of cocaine addiction.	Pan Y, etal., J Med Chem. 2012 Jan 12;55(1):357-66. doi: 10.1021/jm201231w. Epub 2011 Dec 30.
36.	Electromyographic activity of rat ischiocavernosus muscles during copulation after treatment with a GABA-transaminase inhibitor.	Paredes RG, etal., Behav Neural Biol. 1993 Sep;60(2):118-22.
37.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
38.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
39.	Glucose promotion of GABA metabolism contributes to the stimulation of insulin secretion in beta-cells.	Pizarro-Delgado J, etal., Biochem J. 2010 Nov 1;431(3):381-9. doi: 10.1042/BJ20100714.
40.	The effect of chronic treatment with the GABA transaminase inhibitors gamma-vinyl-GABA and ethanolamine-O-sulphate on the in vivo release of GABA from rat hippocampus.	Qume M, etal., J Neurochem. 1995 May;64(5):2256-61.
41.	Effect of vigabatrin on contractile response to arachidonic acid and prostaglandins in smooth muscle preparations and platelet aggregation in experimental laboratory animals.	Raza M and Al-Shabanah OA, Pharmacol Res. 2003 Jun;47(6):477-83.
42.	GOA pipeline	RGD automated data pipeline
43.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
44.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
45.	An analysis of the cortical and striatal involvement in dyskinesia induced in rats by intracerebral injection of GABA-transaminase inhibitors and picrotoxin.	Robin MM, etal., Eur J Pharmacol. 1980 Apr 4;62(4):319-27.
46.	Inhibitors of GABA metabolism: implications for Huntington's disease.	Schwarcz R, etal., Ann Neurol. 1977 Oct;2(4):299-303.
47.	Suppression of haloperidol-induced oral dyskinesias in rats by vigabatrin.	Seiler N, etal., Pharmacol Biochem Behav. 1995 Feb;50(2):181-9.
48.	Effects of chronic treatment with the GABA-transaminase inhibitor vigabatrin on exploratory behaviour in rats.	Sherif F and Oreland L, Behav Brain Res. 1994 Jul 29;63(1):11-5.
49.	Effect of the GABA-transaminase inhibitor vigabatrin on exploratory behaviour in socially isolated rats.	Sherif F and Oreland L, Behav Brain Res. 1995 Dec 14;72(1-2):135-40.
50.	GABA-transaminase activity in rat and human brain: regional, age and sex-related differences.	Sherif F, etal., J Neural Transm Gen Sect. 1991;84(1-2):95-102.
51.	Increase in brain GABA-transaminase activity after chronic ethanol treatment in rats.	Sherif F, etal., J Neural Transm Gen Sect. 1994;98(1):69-79.
52.	Brain gamma-aminobutyrate aminotransferase (GABA-T) and monoamine oxidase (MAO) in patients with Alzheimer's disease.	Sherif F, etal., J Neural Transm Park Dis Dement Sect. 1992;4(3):227-40.
53.	Effects of gamma-vinyl GABA (vigabatrin) on blood pressure and body weight of hypertensive and normotensive rats.	Singewald N, etal., Naunyn Schmiedebergs Arch Pharmacol. 1992 Feb;345(2):181-6.
54.	Enhanced GABAergic tone in the ventral pallidum: memory of unpleasant experiences?	Skirzewski M, etal., Neuroscience. 2011 Nov 24;196:131-46. doi: 10.1016/j.neuroscience.2011.08.058. Epub 2011 Aug 30.
55.	Increased dopamine release from rat striatal slices by inhibitors of GABA-aminotransferase.	Stoof JC and Mulder AH, Eur J Pharmacol. 1977 Nov 15;46(2):177-80.
56.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
57.	Submitochondrial localization of rat liver beta-alanine-oxoglutarate aminotransferase.	Tamaki N, etal., J Nutr Sci Vitaminol (Tokyo). 1987 Dec;33(6):439-49.
58.	Purification, properties, and sequencing of aminoisobutyrate aminotransferases from rat liver.	Tamaki N, etal., Methods Enzymol 2000;324:376-89.
59.	Contrasting effects of the GABA transaminase inhibitors gamma-vinylGABA and aminooxyacetic acid on arterial pressure following injection into nucleus tractus solitarius.	Tsukamoto K and Sved AF, Neuropharmacology. 1993 Jun;32(6):575-9.
60.	Treatment of epilepsy: the GABA-transaminase inhibitor, vigabatrin, induces neuronal plasticity in the mouse retina.	Wang QP, etal., Eur J Neurosci. 2008 Apr;27(8):2177-87. doi: 10.1111/j.1460-9568.2008.06175.x.
61.	Increased mesolimbic GABA concentration blocks heroin self-administration in the rat.	Xi ZX and Stein EA, J Pharmacol Exp Ther. 2000 Aug;294(2):613-9.
62.	Detection of reduced GABA synthesis following inhibition of GABA transaminase using in vivo magnetic resonance signal of GABA C1.	Yang J, etal., J Neurosci Methods. 2009 Sep 15;182(2):236-43. doi: 10.1016/j.jneumeth.2009.06.015. Epub 2009 Jun 21.
63.	Assessment of the treatment effect of baicalein on a model of Parkinsonian tremor and elucidation of the mechanism.	Yu X, etal., Life Sci. 2012 Jul 26;91(1-2):5-13. doi: 10.1016/j.lfs.2012.05.005. Epub 2012 May 23.

Additional References at PubMed

PMID:648527	PMID:6470007	PMID:10850552	PMID:11561735	PMID:14651853	PMID:15489334	PMID:15528998	PMID:15650327	PMID:18614015	PMID:23376485	PMID:24809054	PMID:31534049
PMID:32357304

Genomics

Comparative Map Data

Abat
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	7,503,351 - 7,599,474 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	7,492,022 - 7,599,474 (-)	Ensembl				GRCr8
mRatBN7.2	10	6,996,688 - 7,092,835 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	6,999,819 - 7,092,835 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	11,705,905 - 11,800,150 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	11,202,332 - 11,296,694 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	6,853,860 - 6,945,716 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	7,093,406 - 7,200,439 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	7,093,405 - 7,200,499 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	5,894,187 - 6,002,068 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	7,040,725 - 7,137,154 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	5,995,207 - 6,088,218 (-)	NCBI		Celera
RGSC_v3.1	10	7,040,724 - 7,137,154 (-)	NCBI
Cytogenetic Map	10	q12	NCBI

ABAT
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	8,674,617 - 8,784,570 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	8,674,596 - 8,784,575 (+)	Ensembl			hg38	GRCh38
GRCh37	16	8,768,474 - 8,878,427 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	8,675,928 - 8,785,933 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	16	8,675,945 - 8,785,932	NCBI
Celera	16	8,937,805 - 9,047,806 (+)	NCBI		Celera
Cytogenetic Map	16	p13.2	NCBI
HuRef	16	8,691,116 - 8,800,895 (+)	NCBI		HuRef
CHM1_1	16	8,768,357 - 8,878,342 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	8,707,289 - 8,817,330 (+)	NCBI		T2T-CHM13v2.0

Abat
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	8,331,293 - 8,439,432 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	8,331,293 - 8,439,432 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	16	8,513,429 - 8,621,568 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	8,513,429 - 8,621,568 (+)	Ensembl			mm10	GRCm38
MGSCv37	16	8,513,522 - 8,621,661 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	16	8,428,810 - 8,536,889 (+)	NCBI		MGSCv36	mm8
Celera	16	9,158,444 - 9,266,822 (+)	NCBI		Celera
Cytogenetic Map	16	A1	NCBI
cM Map	16	4.06	NCBI

Abat
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955442	9,422,849 - 9,516,103 (-)	Ensembl
ChiLan1.0	NW_004955442	9,422,849 - 9,516,054 (-)	NCBI	ChiLan1.0	ChiLan1.0

ABAT
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	9,201,692 - 9,323,956 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	12,999,815 - 13,108,612 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	7,609,282 - 7,718,049 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	8,850,010 - 8,958,420 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	8,888,178 - 8,958,420 (+)	Ensembl			panPan2	panpan1.1

ABAT
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	33,385,779 - 33,471,348 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	33,376,996 - 33,471,326 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	34,776,452 - 34,862,027 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	33,584,479 - 33,670,069 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	33,584,487 - 33,670,052 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	33,386,823 - 33,472,421 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	33,256,654 - 33,342,147 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	33,678,493 - 33,764,059 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Abat
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	109,698,256 - 109,775,982 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936530	7,543,682 - 7,622,667 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936530	7,543,743 - 7,621,392 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ABAT
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	33,908,970 - 34,015,474 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	3	33,913,068 - 33,960,804 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	34,642,449 - 34,682,257 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ABAT
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	8,274,310 - 8,380,973 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	8,315,952 - 8,379,549 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666068	21,840,065 - 21,946,865 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Abat
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624824	6,141,213 - 6,202,936 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624824	6,112,644 - 6,202,936 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Abat
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	9	13,413,444 - 13,506,271 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Abat
788 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	24
Count of miRNA genes:	21
Interacting mature miRNAs:	24
Transcripts:	ENSRNOT00000003633
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5893811	50893811	Rat
631660	Hcar1	Hepatocarcinoma resistance QTL 1	3.4	0.0001	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	10	6661118	35509383	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6660923	73950353	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5893811	50893811	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1250554	64349221	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5893811	50893811	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6877142	51877142	Rat
2293680	Bss40	Bone structure and strength QTL 40	5.66	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	10	1	35730538	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5893811	50893811	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6864618	96620484	Rat
7387235	Uae41	Urinary albumin excretion QTL 41	5.26	0.1874	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	10	1	30004247	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	922197	45922197	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	2103708	47103708	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5893811	50893811	Rat
631828	Alc5	Alcohol consumption QTL 5	2.4		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	1	17749933	Rat
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38832698	Rat

Markers in Region

STS-Z39377

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	7,091,152 - 7,091,407 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	7,198,754 - 7,199,008	NCBI	Rnor6.0
Rnor_5.0	10	6,000,383 - 6,000,637	UniSTS	Rnor5.0
RGSC_v3.4	10	7,135,469 - 7,135,723	UniSTS	RGSC3.4
Celera	10	6,086,536 - 6,086,790	UniSTS
Cytogenetic Map	10	q12	UniSTS

Genetic Models

This gene Abat is modified in the following models/strains:

F344-Abat^{Tn(sb-T2/Bart3)2.163Mcwi}

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	64	163	91	90	59	85	59	6	346	182	11	142	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006245760	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269943	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC081787	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D87839	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U29701	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000003633 ⟹ ENSRNOP00000003633

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	7,506,480 - 7,599,474 (-)	Ensembl
mRatBN7.2 Ensembl	10	6,999,819 - 7,092,835 (-)	Ensembl
Rnor_6.0 Ensembl	10	7,093,405 - 7,200,499 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096222 ⟹ ENSRNOP00000083566

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	7,522,794 - 7,599,474 (-)	Ensembl
mRatBN7.2 Ensembl	10	7,016,140 - 7,092,835 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000118904 ⟹ ENSRNOP00000082381

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	7,506,480 - 7,599,474 (-)	Ensembl
mRatBN7.2 Ensembl	10	6,999,819 - 7,092,835 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000172951 ⟹ ENSRNOP00000107913

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	7,492,022 - 7,599,474 (-)	Ensembl

RefSeq Acc Id:

NM_031003 ⟹ NP_112265

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	7,506,480 - 7,599,474 (-)	NCBI
mRatBN7.2	10	6,999,819 - 7,092,835 (-)	NCBI
Rnor_6.0	10	7,094,258 - 7,200,439 (-)	NCBI
Rnor_5.0	10	5,894,187 - 6,002,068 (-)	NCBI
RGSC_v3.4	10	7,040,725 - 7,137,154 (-)	RGD
Celera	10	5,995,207 - 6,088,218 (-)	RGD

Sequence:

show sequence

GATCGCGCAAGTCGGACCCGTGGATCACAGCCTGTAGATCGCGGCCCGGGCCTGGAGGACAACA
GCAAGTGAAGGGGGTTCCTCTTCCTGAAGGAGGGGTCATGGCCTTCTTGTTGACTACCCGACGG
CTGGTCTGCAGTTCCCAGAAAAACCTCCACCTCTTCACACCTGGATCCAGATACATCAGCCAAG
CTGCTGCCAAAGTTGACTTTGAGTTTGATTATGATGGACCACTCATGAAGACAGAAGTCCCGGG
CCCTAGATCTCAGGAGCTAATGAAACAGCTGAACACAATCCAGAATGCAGAGGCCGTGCACTTT
TTCTGCAACTACGAAGAGAGCCGAGGCAACTACCTCGTGGACGTGGATGGCAACCGCATGTTGG
ACCTGTATTCTCAGATCTCCTCTGTACCCATCGGTTACAACCATCCGGCTCTGGCGAAACTCGT
TCAACAGCCTCAAAACGCGAGCACTTTCATCAACAGACCTGCCCTGGGCATCCTGCCTCCAGAG
AACTTTGTGGACAAGCTCCGGGAGTCCTTGATGTCGGTGGCGCCCAAAGGCATGTGTCAGCTCA
TCACGATGGCCTGCGGGTCCTGCTCCAATGAGAATGCATTCAAGACCATCTTCATGTGGTACCG
GAGTAAAGAACGAGGTCAGAGAGGTTTCTCCAAAGAGGAGCTGGAGACTTGCATGGTTAACCAG
AGTCCTGGATGCCCAGACTACAGCATCCTCTCCTTCATGGGTGCTTTCCACGGGAGGACCATGG
GTTGCTTAGCGACCACACACTCCAAAGCAATTCACAAGATTGACATCCCTTCCTTTGACTGGCC
CATTGCTCCATTCCCACGGCTGAAATATCCCCTGGAGGAGTTTGTGACGGACAATCAGCAAGAG
GAGGCCCGCTGTCTAGAAGAGGTGGAGGATCTAATTGTGAAATATCGGAAAAAGAAGAGAACAG
TGGCTGGGATCATCGTGGAGCCCATCCAGTCCGAAGGTGGAGACAACCACGCATCAGATGACTT
CTTCCGGAAGCTGAGAGACATAGCCAGGAAGCATGGCTGTGCCTTCTTGGTGGACGAGGTTCAG
ACTGGAGGAGGCTGTACAGGCAAGTTCTGGGCCCATGAACACTGGGGCTTGGATGACCCAGCCG
ACGTGATGTCGTTCAGCAAGAAGATGATGACTGGGGGCTTCTTCCACAAGGAGGAGTTTCGACC
AAGTGCTCCTTACCGGATCTTCAACACCTGGCTGGGGGACCCATCCAAGAACTTGCTGCTGGCT
GAGGTCATCAACATCATCAAGCGGGAAGACCTGCTCAACAACGTGGCCCATGCCGGGAAGACCC
TACTGACCGGGCTGCTGGACCTCCAGGCCCAGTACCCCCAGTTCGTCAGCCGGGTGAGGGGACG
AGGCACCTTCTGTTCCTTCGACACTCCCGACAAAGCCATACGGAATAAACTCATCCTAATTGCC
AGGAACAAAGGTGTGGTACTGGGGGGCTGCGGTGACAAATCCATACGTTTCCGTCCCACGCTGG
TCTTCAGGGATCACCATGCCCACTTGTTCCTCAACATTTTCAGTGGTATCTTAGCAGACTTCAA
GTAAAGAAGCCATCTCCACGACATTCAGAGAAAGCTCTGTCCCAGCGGTGTCAACTTGATTAGT
TTGCCTAATTCATATTTTCACTTCAAAGTTTATCAGAGGCGAATGCATAAACTAAAGGGTC

hide sequence

RefSeq Acc Id:

XM_006245760 ⟹ XP_006245822

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	7,503,351 - 7,559,787 (-)	NCBI
mRatBN7.2	10	6,996,688 - 7,053,104 (-)	NCBI
Rnor_6.0	10	7,093,406 - 7,146,498 (-)	NCBI
Rnor_5.0	10	5,894,187 - 6,002,068 (-)	NCBI

Sequence:

show sequence

CCCTCATTAGTTCTCAGGTTCTTCGGATATCCTCCCCTGTCAGATGTGGAGCCAGCAGGTTGCT
CCCACCTGGGCGAGTTGCTTCCTTTGCTGAGGAGAAGCTTGTCGATTTGCTGCTCTCTCCTTTG
TCGGTTCTTGGTTTTGTCTCTTGTGCTGTGGGAGACCTTTCGGAAAGACCTTTCCTGGGCCTGA
GCCTGGAAGTTCTCCATGATCTCTTTTCCCACTTCAGAGTTCCAGGTGTTCAGCAGGAAACAGG
ACAACAGCAAGTGAAGGGGGTTCCTCTTCCTGAAGGAGGGGTCATGGCCTTCTTGTTGACTACC
CGACGGCTGGTCTGCAGTTCCCAGAAAAACCTCCACCTCTTCACACCTGGATCCAGATACATCA
GCCAAGCTGCTGCCAAAGTTGACTTTGAGTTCGATTATGATGGACCACTCATGAAGACAGAAGT
CCCGGGCCCTAGATCTCAGGAGCTAATGAAACAGCTGAACACAATCCAGAATGCAGAGGCCGTG
CACTTTTTCTGCAACTACGAAGAGAGCCGAGGCAACTACCTTGTGGACGTGGATGGCAACCGCA
TGTTGGACCTGTATTCTCAGATCTCCTCTGTACCCATCGGTTACAACCATCCGGCTCTGGCGAA
ACTCGTTCAACAGCCTCAAAATGCGAGCACTTTCATCAACAGACCTGCCCTGGGCATCCTGCCT
CCAGAGAACTTTGTGGACAAGCTCCGGGAGTCCTTGATGTCGGTGGCGCCCAAAGGCATGTGTC
AGCTCATCACGATGGCCTGCGGGTCCTGCTCCAATGAGAATGCATTCAAGACCATCTTCATGTG
GTACCGGAGTAAAGAACGAGGTCAGAGAGGTTTCTCCAAAGAGGAGCTGGAGACTTGCATGGTT
AACCAGAGTCCTGGATGCCCAGACTACAGCATCCTCTCCTTCATGGGTGCTTTCCACGGGAGGA
CCATGGGTTGCTTAGCGACCACACACTCCAAAGCAATTCACAAGATTGACATCCCTTCCTTTGA
CTGGCCCATTGCTCCATTCCCACGGCTGAAATATCCCCTGGAGGAGTTTGTGACGGACAATCAG
CAAGAGGAGGCCCGCTGTCTAGAAGAGGTGGAGGATCTAATTGTGAAATATCGGAAAAAGAAGA
GAACAGTGGCTGGGATCATCGTGGAGCCCATCCAGTCCGAAGGTGGAGACAACCACGCATCAGA
TGACTTCTTCCGGAAGCTGAGAGACATAGCCAGGAAGCATGGCTGTGCCTTCTTGGTGGACGAG
GTTCAGACTGGAGGAGGCTGTACAGGCAAGTTCTGGGCCCATGAACACTGGGGCTTGGATGACC
CAGCCGACGTGATGTCGTTCAGCAAGAAGATGATGACTGGGGGCTTCTTCCACAAGGAGGAGTT
TCGACCAAGTGCTCCTTACCGGATCTTCAACACCTGGCTGGGGGACCCATCCAAGAACTTGCTG
CTGGCTGAGGTCATCAACATCATCAAGCGGGAAGACCTGCTCAACAACGTGGCCCATGCCGGGA
AGACCCTACTGACCGGGCTGCTGGACCTCCAGGCCCAGTACCCCCAGTTCGTCAGCCGGGTGAG
GGGACGAGGCACCTTCTGTTCCTTCGACACTCCCGACGAAGCCATACGGAATAAACTCATCCTA
ATTGCCAGGAACAAAGGTGTGGTACTGGGGGGCTGCGGTGACAAATCCATACGTTTCCGTCCCA
CGCTGGTCTTCAGGGATCACCATGCCCACTTGTTCCTCAACATTTTCAGTGGTATCTTAGCAGA
CTTCAAGTAAAGAAGCCATCTCCACGACATTCAGAGAAAGCTCTGTCCCAGCGGTGTCAACTTG
ATTAGTTTGCCTAATTCATATTTTCACTTCAAAGTTTATCAGAGGCGAATGCATAAACTAAAGG
GTCATTTGTGGGGCAGGCTCAATGGCGAGTGCGTGTGGAGGATCGGGTGGGAGGACCATGCTTT
GAGGAACGCCCCTCTCAGAGTTCATGGTGGCCATTGGTTAAAGCCCAAAAGTTCTGTGTAAGCC
TTGAACACTGTCTTAGGAAAGGCCATGAGGCCGAATTTCTGCCAACCCTGGACCAACCAGTCTC
TTAGAAGCCACTCAAGGGCATTACACTTGCTCCGAGGTGGGTGGGTCTCTGCCCACCTCAAGTA
CCCAGTCTTGGGATCAGAGATAATGGCATCCTCTTGTCCCTCACAAACAAAACTCACGTGGCTT
CTCACTCCCAAGTCCCTACTCCATGCCCCACTCGTGACTTCTGAGGGTCTGGATGGCTGTCAGG
AATATGACAAGGTGGGAAGATAATGACTGTGTTTGGAGGCGTAGAGAGGCTTCCAGTATCCTCA
ACACCAAGATCCACTCAGCCCTGTACCCAGTGATGTCCCTGGCCTATGAATTCTGTCCTTGACT
GGCCCGTGCTCCTGGAGGATCTCTGAGTTGTGTCAGTGACAGTTTAGTCACCACTCCCCACCCT
GTGTCAAGCTTGACTCATGGAAAGGAGATGACATCCTGAGTGTCCCAGAGACTCATGGGACCTG
AAGTCGCCTCTGGAGCCTCCGCTGAGGAACACGGGCAGCAGAACCCCTTCGTGCCAGCTCCAGG
GCCTCTGGCTTGTGGCCCCCTCACCCTGGGAACACCACAGTCCATCTTTCACCCACCCACTTCT
CTCCATTCCTGAGCAGGGCTAGTCCATCCCAGAGGGCTACTGTAGGGGCAATGTGTTCATTATA
AAGGCACAAGGACAACACCCACG

hide sequence

RefSeq Acc Id:

XM_063269943 ⟹ XP_063126013

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	7,503,351 - 7,550,292 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_112265	(Get FASTA)	NCBI Sequence Viewer
	XP_006245822	(Get FASTA)	NCBI Sequence Viewer
	XP_063126013	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA70415	(Get FASTA)	NCBI Sequence Viewer
	AAH81787	(Get FASTA)	NCBI Sequence Viewer
	BAA25570	(Get FASTA)	NCBI Sequence Viewer
	EDL96243	(Get FASTA)	NCBI Sequence Viewer
	EDL96244	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000003633
	ENSRNOP00000003633.2
GenBank Protein	P50554	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_112265 ⟸ NM_031003

- UniProtKB:

A0A8I6G7C5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAFLLTTRRLVCSSQKNLHLFTPGSRYISQAAAKVDFEFDYDGPLMKTEVPGPRSQELMKQLNT
IQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYNHPALAKLVQQPQNASTFINR
PALGILPPENFVDKLRESLMSVAPKGMCQLITMACGSCSNENAFKTIFMWYRSKERGQRGFSKE
ELETCMVNQSPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPSFDWPIAPFPRLKYPLE
EFVTDNQQEEARCLEEVEDLIVKYRKKKRTVAGIIVEPIQSEGGDNHASDDFFRKLRDIARKHG
CAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMSFSKKMMTGGFFHKEEFRPSAPYRIFNTWLG
DPSKNLLLAEVINIIKREDLLNNVAHAGKTLLTGLLDLQAQYPQFVSRVRGRGTFCSFDTPDKA
IRNKLILIARNKGVVLGGCGDKSIRFRPTLVFRDHHAHLFLNIFSGILADFK

hide sequence

RefSeq Acc Id:	XP_006245822 ⟸ XM_006245760
- Peptide Label:	isoform X1
- UniProtKB:	O70539 (UniProtKB/Swiss-Prot), Q66HM1 (UniProtKB/Swiss-Prot), P50554 (UniProtKB/Swiss-Prot), A6K4M1 (UniProtKB/TrEMBL), A0A8I6G7C5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAFLLTTRRLVCSSQKNLHLFTPGSRYISQAAAKVDFEFDYDGPLMKTEVPGPRSQELMKQLNT IQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYNHPALAKLVQQPQNASTFINR PALGILPPENFVDKLRESLMSVAPKGMCQLITMACGSCSNENAFKTIFMWYRSKERGQRGFSKE ELETCMVNQSPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPSFDWPIAPFPRLKYPLE EFVTDNQQEEARCLEEVEDLIVKYRKKKRTVAGIIVEPIQSEGGDNHASDDFFRKLRDIARKHG CAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMSFSKKMMTGGFFHKEEFRPSAPYRIFNTWLG DPSKNLLLAEVINIIKREDLLNNVAHAGKTLLTGLLDLQAQYPQFVSRVRGRGTFCSFDTPDEA IRNKLILIARNKGVVLGGCGDKSIRFRPTLVFRDHHAHLFLNIFSGILADFK hide sequence

Ensembl Acc Id:

ENSRNOP00000003633 ⟸ ENSRNOT00000003633

Ensembl Acc Id:

ENSRNOP00000083566 ⟸ ENSRNOT00000096222

Ensembl Acc Id:

ENSRNOP00000082381 ⟸ ENSRNOT00000118904

RefSeq Acc Id:	XP_063126013 ⟸ XM_063269943
- Peptide Label:	isoform X1
- UniProtKB:	Q66HM1 (UniProtKB/Swiss-Prot), P50554 (UniProtKB/Swiss-Prot), O70539 (UniProtKB/Swiss-Prot), A6K4M1 (UniProtKB/TrEMBL), A0A8I6G7C5 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000107913 ⟸ ENSRNOT00000172951

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P50554-F1-model_v2	AlphaFold	P50554	1-500	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696954

Promoter ID:

EPDNEW_R7479

Type:

multiple initiation site

Name:

Abat_1

Description:

4-aminobutyrate aminotransferase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	7,200,476 - 7,200,536	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620948	AgrOrtholog
BioCyc Gene	G2FUF-26094	BioCyc
BioCyc Pathway	BETA-ALA-DEGRADATION-I-PWY [beta-alanine degradation I]	BioCyc
	GLUDEG-I-PWY [GABA shunt]	BioCyc
	PWY-6535 [4-aminobutanoate degradation I]	BioCyc
	VALDEG-PWY [L-valine degradation I]	BioCyc
BioCyc Pathway Image	BETA-ALA-DEGRADATION-I-PWY	BioCyc
	GLUDEG-I-PWY	BioCyc
	PWY-6535	BioCyc
	VALDEG-PWY	BioCyc
Ensembl Genes	ENSRNOG00000002636	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000003633	ENTREZGENE
	ENSRNOT00000003633.5	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.640.10	UniProtKB/Swiss-Prot
	3.90.1150.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7109775	IMAGE-MGC_LOAD
InterPro	4NH2But_aminotransferase_euk	UniProtKB/Swiss-Prot
	Aminotrans_3	UniProtKB/Swiss-Prot
	Aminotrans_3_PPA_site	UniProtKB/Swiss-Prot
	PyrdxlP-dep_Trfase	UniProtKB/Swiss-Prot
	PyrdxlP-dep_Trfase_dom1	UniProtKB/Swiss-Prot
	PyrdxlP-dep_Trfase_major	UniProtKB/Swiss-Prot
KEGG Report	rno:81632	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93392	IMAGE-MGC_LOAD
NCBI Gene	81632	ENTREZGENE
PANTHER	4-AMINOBUTYRATE AMINOTRANSFERASE, MITOCHONDRIAL	UniProtKB/Swiss-Prot
	AMINOTRANSFERASE	UniProtKB/Swiss-Prot
Pfam	Aminotran_3	UniProtKB/Swiss-Prot
PharmGKB	ABAT	RGD
PhenoGen	Abat	PhenoGen
PIRSF	Transaminase_4ab_Lys_Orn	UniProtKB/Swiss-Prot
PROSITE	AA_TRANSFER_CLASS_3	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000002636	RatGTEx
Superfamily-SCOP	SSF53383	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZW33_RAT	UniProtKB/TrEMBL
	A0A8I6G7C5	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LBA6_RAT	UniProtKB/TrEMBL
	A6K4M1	ENTREZGENE, UniProtKB/TrEMBL
	A6K4M2_RAT	UniProtKB/TrEMBL
	GABT_RAT	UniProtKB/Swiss-Prot
	O70539	ENTREZGENE
	P50554	ENTREZGENE
	Q66HM1	ENTREZGENE
UniProt Secondary	O70539	UniProtKB/Swiss-Prot
	Q66HM1	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Abat	4-aminobutyrate aminotransferase			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Abat	4-aminobutyrate aminotransferase			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in brain, cerebellar cortex ,liver, kidney, and testis	631979
gene_protein	466 amino acids	631980
gene_protein	proteolytically cleaved in two steps in the mitochondria to produce brain- and liver-specific forms	631979
gene_protein	proteolytically cleaved in two steps in the mitochondria to produce brain- and liver-specific forms	631980
gene_regulation	active enzyme in brain is larger than in liver due to use of a second proteolytic cleavage site

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways