Advanced Search (OLGA)

Gene: Rab4b (RAB4B, member RAS oncogene family) Rattus norvegicus

Analyze

Symbol:

Rab4b

Name:

RAB4B, member RAS oncogene family

RGD ID:

620931

Description:

Predicted to enable G protein activity and GTP binding activity. Predicted to be involved in several processes, including D-glucose import; early endosome to Golgi transport; and endosomal vesicle fusion. Is active in synaptic vesicle membrane. Orthologous to human RAB4B (RAB4B, member RAS oncogene family); INTERACTS WITH acrylamide; ammonium chloride; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ras-related GTP-binding protein 4b; ras-related protein Rab-4B

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RAB4B (RAB4B, member RAS oncogene family)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rab4b (RAB4B, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rab4b (RAB4B, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RAB4B (RAB4B, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RAB4B (RAB4B, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rab4b (RAB4B, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RAB4B (RAB4B, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RAB4B (RAB4B, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rab4b (RAB4B, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Rab4b (RAB4B, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RAB4A (RAB4A, member RAS oncogene family)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	RAB4B (RAB4B, member RAS oncogene family)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rab4b (RAB4B, member RAS oncogene family)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rab4b (RAB4B, member RAS oncogene family)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rab4b (RAB4B, member RAS oncogene family)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Rab4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rab4b	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rab4b	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	91,589,047 - 91,600,426 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	91,589,047 - 91,600,337 (-)	Ensembl				GRCr8
mRatBN7.2	1	82,461,396 - 82,472,784 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	82,461,396 - 82,472,763 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	87,864,851 - 87,876,094 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	96,351,189 - 96,362,658 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	89,620,716 - 89,631,960 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	83,979,298 - 83,990,680 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	83,979,298 - 83,990,588 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	85,190,236 - 85,201,597 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	82,242,920 - 82,254,443 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	76,874,595 - 76,885,960 (-)	NCBI		Celera
RGSC_v3.1	1	82,321,030 - 82,332,554 (-)	NCBI
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Prostatic Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

acrylamide (EXP,ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

Butylbenzyl phthalate (EXP)

cadmium dichloride (ISO)

calcitriol (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

clofibrate (ISO)

DDT (EXP)

dexamethasone (ISO)

dextran sulfate (ISO)

dibutyl phthalate (EXP)

doxorubicin (ISO)

Evodiamine (ISO)

flavonoids (EXP)

indometacin (ISO)

okadaic acid (ISO)

paracetamol (EXP,ISO)

perfluorohexanesulfonic acid (ISO)

phenobarbital (EXP)

pirinixic acid (ISO)

resveratrol (ISO)

S-nitrosoglutathione (ISO)

silicon dioxide (ISO)

sodium fluoride (ISO)

testosterone (ISO)

titanium dioxide (ISO)

triptonide (ISO)

venlafaxine hydrochloride (EXP)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

D-glucose import (IEA,ISO)

early endosome to Golgi transport (IEA,ISO)

endosomal vesicle fusion (IEA,ISO)

protein transport (IEA)

Rab protein signal transduction (IEA)

regulation of endocytosis (IBA)

vesicle-mediated transport (IBA)

Cellular Component

cytosol (IEA)

early endosome membrane (IEA,ISO)

insulin-responsive compartment (IBA,IEA,ISO)

membrane (IEA)

perinuclear region of cytoplasm (IEA,ISO)

plasma membrane (IEA)

recycling endosome (IBA,IEA,ISO)

synaptic vesicle membrane (EXP,IDA,IEA,IEP,IMP)

Molecular Function

G protein activity (IEA,ISO,ISS)

GTP binding (IBA,IEA)

GTPase activity (IBA,IEA,ISO)

hydrolase activity (IEA)

metal ion binding (IEA)

nucleotide binding (IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.	Quantitative analysis of synaptic vesicle Rabs uncovers distinct yet overlapping roles for Rab3a and Rab27b in Ca2+-triggered exocytosis.	Pavlos NJ, etal., J Neurosci. 2010 Oct 6;30(40):13441-53. doi: 10.1523/JNEUROSCI.0907-10.2010.
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:18614015	PMID:19590752	PMID:28131823

Genomics

Comparative Map Data

Rab4b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	91,589,047 - 91,600,426 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	91,589,047 - 91,600,337 (-)	Ensembl				GRCr8
mRatBN7.2	1	82,461,396 - 82,472,784 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	82,461,396 - 82,472,763 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	87,864,851 - 87,876,094 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	96,351,189 - 96,362,658 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	89,620,716 - 89,631,960 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	83,979,298 - 83,990,680 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	83,979,298 - 83,990,588 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	85,190,236 - 85,201,597 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	82,242,920 - 82,254,443 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	76,874,595 - 76,885,960 (-)	NCBI		Celera
RGSC_v3.1	1	82,321,030 - 82,332,554 (-)	NCBI
Cytogenetic Map	1	q21	NCBI

RAB4B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	40,778,247 - 40,796,942 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	40,778,195 - 40,798,690 (+)	Ensembl			hg38	GRCh38
GRCh37	19	41,284,152 - 41,302,847 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	45,976,011 - 45,994,687 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	45,976,791 - 45,994,682	NCBI
Celera	19	38,084,575 - 38,103,255 (+)	NCBI		Celera
Cytogenetic Map	19	q13.2	NCBI
HuRef	19	37,717,378 - 37,736,083 (+)	NCBI		HuRef
CHM1_1	19	41,283,810 - 41,302,517 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	43,598,926 - 43,617,621 (+)	NCBI		T2T-CHM13v2.0

Rab4b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	26,867,858 - 26,878,308 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	26,867,849 - 26,878,321 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	27,168,433 - 27,178,883 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	27,168,424 - 27,178,896 (-)	Ensembl			mm10	GRCm38
MGSCv37	7	27,953,452 - 27,963,902 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	26,877,193 - 26,887,643 (-)	NCBI		MGSCv36	mm8
Celera	7	21,745,304 - 21,755,667 (-)	NCBI		Celera
Cytogenetic Map	7	A3	NCBI
cM Map	7	15.84	NCBI

Rab4b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955578	559,029 - 568,966 (-)	Ensembl
ChiLan1.0	NW_004955578	559,029 - 568,966 (-)	NCBI	ChiLan1.0	ChiLan1.0

RAB4B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	47,036,282 - 47,054,992 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	48,907,245 - 48,925,938 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	37,821,564 - 37,840,257 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	46,328,788 - 46,346,492 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	46,328,788 - 46,346,492 (+)	Ensembl			panPan2	panpan1.1

RAB4B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	113,003,317 - 113,011,978 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	113,003,318 - 113,011,947 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	112,405,739 - 112,414,369 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	113,601,754 - 113,610,422 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	113,598,051 - 113,610,378 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	113,161,162 - 113,169,787 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	112,793,150 - 112,801,779 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	113,787,264 - 113,795,890 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Rab4b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	14,621,751 - 14,631,852 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936661	3,049,638 - 3,059,963 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936661	3,049,802 - 3,059,921 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RAB4B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	48,989,172 - 48,999,608 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	48,989,080 - 49,010,042 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	44,673,741 - 44,686,963 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RAB4B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	35,231,448 - 35,249,080 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	35,231,490 - 35,251,111 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666073	13,368,248 - 13,386,685 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rab4b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624925	697,267 - 704,465 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624925	697,224 - 708,865 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Rab4b
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	168,763,783 - 168,777,726 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Rab4b
98 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	174
Count of miRNA genes:	125
Interacting mature miRNAs:	136
Transcripts:	ENSRNOT00000002052
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	51940904	101229020	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	87889942	132889942	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	39728272	132889942	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	86622262	131622262	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	58769992	103769992	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	66077886	111077886	Rat
1331800	Scl25	Serum cholesterol level QTL 25	3.013		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	87785026	142582336	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	83019780	128019780	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	52891222	109116986	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	66404680	111404680	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	86993904	131993904	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	81269860	99645535	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	87558587	132558587	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	66400974	132889942	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	84107164	115183752	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	91302413	136302413	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	65405637	96805205	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	162	91	90	59	92	59	6	356	192	11	141	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017355	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017589608	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271933	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005491051	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC123095	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227674	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X78605	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000002052 ⟹ ENSRNOP00000002052

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	91,589,047 - 91,600,337 (-)	Ensembl
mRatBN7.2 Ensembl	1	82,461,397 - 82,472,763 (-)	Ensembl
Rnor_6.0 Ensembl	1	83,979,298 - 83,990,588 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094548 ⟹ ENSRNOP00000090161

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	91,589,047 - 91,597,980 (-)	Ensembl
mRatBN7.2 Ensembl	1	82,461,396 - 82,470,329 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000098489 ⟹ ENSRNOP00000084856

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	91,589,047 - 91,600,337 (-)	Ensembl
mRatBN7.2 Ensembl	1	82,462,437 - 82,472,722 (-)	Ensembl

RefSeq Acc Id:

NM_017355 ⟹ NP_059051

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	91,589,047 - 91,600,337 (-)	NCBI
mRatBN7.2	1	82,461,396 - 82,472,688 (-)	NCBI
Rnor_6.0	1	83,979,298 - 83,990,588 (-)	NCBI
Rnor_5.0	1	85,190,236 - 85,201,597 (-)	NCBI
RGSC_v3.4	1	82,242,920 - 82,254,443 (-)	RGD
Celera	1	76,874,595 - 76,885,960 (-)	RGD

Sequence:

show sequence

GTGGAGCGGCTGCCAGCCGGGGAACAGGCGCGGCCGCGGCGCCATATTGCGGCCCTCAGCGGTC
GCCACCGAGCCATGGCTGAGACCTACGACTTCCTCTTCAAATTCCTGGTGATTGGCAGTGCCGG
AACTGGCAAATCATGTCTCCTCCATCAGTTTATTGAGAATAAGTTCAAACAGGACTCCAACCAC
ACTATTGGCGTGGAGTTTGGATCCAGGGTTGTCAACGTTGGGGGGAAGACTGTGAAGCTACAGA
TTTGGGATACTGCTGGCCAGGAGCGGTTTCGGTCGGTGACACGGAGTTATTACCGAGGGGCAGC
TGGAGCCCTGCTGGTGTATGACATCACCAGCCGGGAGACATACAACTCGCTAGCTGCTTGGCTG
ACCGATGCCCGGACGCTGGCCAGCCCCAACATCGTGGTCATCCTCTGTGGCAACAAGAAGGACC
TGGATCCTGAGCGTGAGGTCACTTTCCTAGAGGCTTCCCGCTTTGCTCAGGAGAATGAGCTGAT
GTTCCTGGAGACCAGCGCTCTCACGGGTGAAAACGTGGAAGAAGCTTTCCTGAAGTGCGCACGC
ACCATCCTCAACAAGATCGACTCAGGTGAACTAGATCCGGAGAGGATGGGCTCAGGCATTCAGT
ATGGTGACATATCTCTTCGCCAGCTGCGGCAGCCTCGCAGTGCCCAGGCCGTGGCCCCTCAGCC
CTGTGGCTGCTGAGACGTGCAGAGCCAGCTCACCTGTTCTTCTGGACCAGCCCTGCTCGAAGGC
TGGGGCTCAGAACCAGGCCCCAAGAGGCCAGGCCCCAATCTGCCCCAGTCCCAGAAAAGTTACT
CCATCACCCATCCCCCTCCCCTGGCCTGCTGGGGCCTGGCTTTGGGGCAAGATTGAGCCACAGG
GGAAAGGGGACCCCATACCTGCTGCTGCTTCCTCTGTCTTGGCTAACTCTAGTCCCCCTCCCCG
AGCCCCTAACCATACCTGAAGAACTCCCAAAGCTTGAGACCAGGGCCAATTGGCCCCAACGTCC
TGCCTGGCCCCGCTGTTGCAAGTCTGTGTTATTTATTACCTGGAGGCCTGTTCCATCCTGTCCC
AGTCCTCCATAAAGCATTGTTTACACCTGTGAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063271933 ⟹ XP_063128003

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	91,589,047 - 91,600,426 (-)	NCBI

RefSeq Acc Id:

XR_005491051

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	91,589,047 - 91,600,426 (-)	NCBI
mRatBN7.2	1	82,461,396 - 82,472,782 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_059051	(Get FASTA)	NCBI Sequence Viewer
	XP_063128003	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAA55339	(Get FASTA)	NCBI Sequence Viewer
	EDM07970	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000002052
	ENSRNOP00000002052.3
GenBank Protein	P51146	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_059051 ⟸ NM_017355

- UniProtKB:

P51146 (UniProtKB/Swiss-Prot), A6J9B4 (UniProtKB/TrEMBL), A0A8I6AD18 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAETYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQIWDT
AGQERFRSVTRSYYRGAAGALLVYDITSRETYNSLAAWLTDARTLASPNIVVILCGNKKDLDPE
REVTFLEASRFAQENELMFLETSALTGENVEEAFLKCARTILNKIDSGELDPERMGSGIQYGDI
SLRQLRQPRSAQAVAPQPCGC

hide sequence

Ensembl Acc Id:

ENSRNOP00000002052 ⟸ ENSRNOT00000002052

Ensembl Acc Id:

ENSRNOP00000090161 ⟸ ENSRNOT00000094548

Ensembl Acc Id:

ENSRNOP00000084856 ⟸ ENSRNOT00000098489

RefSeq Acc Id:	XP_063128003 ⟸ XM_063271933
- Peptide Label:	isoform X1
- UniProtKB:	P51146 (UniProtKB/Swiss-Prot), A6J9B4 (UniProtKB/TrEMBL), A0A8I6AD18 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P51146-F1-model_v2	AlphaFold	P51146	1-213	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689844

Promoter ID:

EPDNEW_R369

Type:

multiple initiation site

Name:

Rab4b_1

Description:

RAB4B, member RAS oncogene family

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	83,990,647 - 83,990,707	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620931	AgrOrtholog
BioCyc Gene	G2FUF-60324	BioCyc
Ensembl Genes	ENSRNOG00000001500	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000002052	ENTREZGENE
	ENSRNOT00000002052.4	UniProtKB/Swiss-Prot
	ENSRNOT00000094548	ENTREZGENE
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot
InterPro	P-loop_NTPase	UniProtKB/Swiss-Prot
	Rab4	UniProtKB/Swiss-Prot
	Rab_GTPases_membrane_traffic	UniProtKB/Swiss-Prot
	Small_GTP-bd_dom	UniProtKB/Swiss-Prot
	Small_GTPase	UniProtKB/Swiss-Prot
KEGG Report	rno:50866	UniProtKB/Swiss-Prot
NCBI Gene	50866	ENTREZGENE
PANTHER	DRAB11-RELATED	UniProtKB/Swiss-Prot
Pfam	Ras	UniProtKB/Swiss-Prot
PhenoGen	Rab4b	PhenoGen
PRINTS	RASTRNSFRMNG	UniProtKB/Swiss-Prot
PROSITE	RAB	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000001500	RatGTEx
SMART	RAB	UniProtKB/Swiss-Prot
	RAN	UniProtKB/Swiss-Prot
	RAS	UniProtKB/Swiss-Prot
	RHO	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot
UniProt	A0A8I6A0H0_RAT	UniProtKB/TrEMBL
	A0A8I6AD18	ENTREZGENE, UniProtKB/TrEMBL
	A6J9B4	ENTREZGENE, UniProtKB/TrEMBL
	P51146	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Rab4b	RAB4B, member RAS oncogene family		ras-related GTP-binding protein 4b	Name updated	1299863	APPROVED
2002-08-07	Rab4b	ras-related GTP-binding protein 4b			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in osteoclasts	704352

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD