Advanced Search (OLGA)

Gene: Gemin2 (gem (nuclear organelle) associated protein 2) Rattus norvegicus

Analyze

Symbol:

Gemin2

Name:

gem (nuclear organelle) associated protein 2

RGD ID:

620842

Description:

Predicted to be involved in spliceosomal snRNP assembly. Predicted to be located in Gemini of Cajal bodies and cytosol. Predicted to be part of SMN complex. Predicted to be active in nucleus. Orthologous to human GEMIN2 (gem nuclear organelle associated protein 2); INTERACTS WITH 1,2,4-trimethylbenzene; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

component of gems 2; gem-associated protein 2; gemin-2; MGC112609; Sip1; SMN interacting protein-1; SMN-interacting protein 1; survival of motor neuron protein interacting protein 1; survival of motor neuron protein-interacting protein 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GEMIN2 (gem nuclear organelle associated protein 2)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Gemin2 (gem nuclear organelle associated protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gemin2 (gem nuclear organelle associated protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GEMIN2 (gem nuclear organelle associated protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GEMIN2 (gem nuclear organelle associated protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gemin2 (gem nuclear organelle associated protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GEMIN2 (gem nuclear organelle associated protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GEMIN2 (gem nuclear organelle associated protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gemin2 (gem nuclear organelle associated protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Gemin2 (gem nuclear organelle associated protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ZDHHC14 (zDHHC palmitoyltransferase 14)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	GEMIN2 (gem nuclear organelle associated protein 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gemin2 (gem nuclear organelle associated protein 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gemin2 (gem (nuclear organelle) associated protein 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Gem2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Gem2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	smi-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	smi-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gemin2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	82,442,419 - 82,456,050 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	82,442,350 - 82,456,048 (+)	Ensembl				GRCr8
mRatBN7.2	6	76,706,424 - 76,721,154 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	76,707,523 - 76,721,153 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	77,159,729 - 77,173,899 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	77,459,052 - 77,473,222 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	76,886,529 - 76,900,699 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	80,108,751 - 80,122,382 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	80,108,655 - 80,122,365 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	89,634,623 - 89,648,254 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	79,708,413 - 79,722,044 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	75,467,807 - 75,481,438 (+)	NCBI		Celera
RGSC_v3.1	6	79,711,444 - 79,725,094 (+)	NCBI
Cytogenetic Map	6	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trimethylbenzene (EXP)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dinitrotoluene (EXP)

4,4'-diaminodiphenylmethane (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

amitrole (EXP)

ammonium chloride (EXP)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

cisplatin (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

cylindrospermopsin (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

dicrotophos (ISO)

Enterolactone (ISO)

enzyme inhibitor (ISO)

ethanol (ISO)

formaldehyde (ISO)

methimazole (EXP)

oxaliplatin (EXP)

paracetamol (EXP)

phenobarbital (ISO)

pirinixic acid (ISO)

quercetin (ISO)

resveratrol (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

tamoxifen (ISO)

testosterone (ISO)

tetrachloromethane (ISO)

thalidomide (ISO)

thioacetamide (EXP)

topotecan (EXP)

triadimefon (EXP)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

mRNA processing (IEA)

protein-containing complex assembly (IEA,ISO)

RNA splicing (IEA)

spliceosomal complex assembly (IEA)

spliceosomal snRNP assembly (IBA,IEA,ISO,ISS)

Cellular Component

cytoplasm (IEA,ISO)

cytosol (IEA,ISO,ISS)

Gemini of Cajal bodies (IEA,ISO,ISS)

nuclear body (IEA,ISO)

nucleus (IBA,IEA,ISO)

SMN complex (IBA,IEA,ISO,ISS)

SMN-Sm protein complex (IEA,ISO,ISS)

spliceosomal complex (IEA)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Information Derived from GenBank Report	RGD, Sept. 2003

Additional References at PubMed

PMID:11181573	PMID:12477932	PMID:18255031	PMID:18984161	PMID:20513430	PMID:23319195

Genomics

Comparative Map Data

Gemin2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	82,442,419 - 82,456,050 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	82,442,350 - 82,456,048 (+)	Ensembl				GRCr8
mRatBN7.2	6	76,706,424 - 76,721,154 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	76,707,523 - 76,721,153 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	77,159,729 - 77,173,899 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	77,459,052 - 77,473,222 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	76,886,529 - 76,900,699 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	80,108,751 - 80,122,382 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	80,108,655 - 80,122,365 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	89,634,623 - 89,648,254 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	79,708,413 - 79,722,044 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	75,467,807 - 75,481,438 (+)	NCBI		Celera
RGSC_v3.1	6	79,711,444 - 79,725,094 (+)	NCBI
Cytogenetic Map	6	q23	NCBI

GEMIN2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	39,114,323 - 39,136,973 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	39,114,285 - 39,139,037 (+)	Ensembl			hg38	GRCh38
GRCh37	14	39,583,527 - 39,606,177 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	38,653,239 - 38,675,928 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	14	38,653,238 - 38,675,926	NCBI
Celera	14	19,448,115 - 19,470,806 (+)	NCBI		Celera
Cytogenetic Map	14	q21.1	NCBI
HuRef	14	19,697,826 - 19,720,403 (+)	NCBI		HuRef
CHM1_1	14	39,582,090 - 39,604,781 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	33,303,000 - 33,325,655 (+)	NCBI		T2T-CHM13v2.0

Gemin2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	59,060,177 - 59,075,256 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	59,060,179 - 59,075,256 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	12	59,013,391 - 59,028,470 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	59,013,393 - 59,028,470 (+)	Ensembl			mm10	GRCm38
MGSCv37	12	60,114,380 - 60,128,975 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	12	59,931,403 - 59,946,480 (+)	NCBI		MGSCv36	mm8
Celera	12	60,176,663 - 60,191,255 (+)	NCBI		Celera
Cytogenetic Map	12	C1	NCBI
cM Map	12	25.99	NCBI

Gemin2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955409	22,142,078 - 22,153,698 (-)	Ensembl
ChiLan1.0	NW_004955409	22,142,082 - 22,153,699 (-)	NCBI	ChiLan1.0	ChiLan1.0

GEMIN2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	40,446,187 - 40,470,073 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	39,662,696 - 39,686,587 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	19,884,100 - 19,906,823 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	38,240,343 - 38,262,370 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	38,240,379 - 38,261,925 (+)	Ensembl			panPan2	panpan1.1

GEMIN2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	17,305,884 - 17,328,698 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	17,305,907 - 17,328,582 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	17,117,065 - 17,139,877 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	17,428,117 - 17,450,935 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	17,428,138 - 17,452,018 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	17,115,718 - 17,138,520 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	17,187,396 - 17,210,186 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	17,473,998 - 17,496,784 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gemin2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	49,211,834 - 49,230,122 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936494	12,717,268 - 12,740,193 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936494	12,717,358 - 12,737,019 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GEMIN2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	169,676,156 - 169,701,481 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	1	169,676,152 - 169,701,475 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	188,436,304 - 188,461,158 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GEMIN2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	15,886,441 - 15,909,137 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666053	4,929,914 - 4,952,589 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gemin2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624813	8,577,158 - 8,593,625 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624813	8,577,291 - 8,593,625 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Gemin2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	7	72,311,025 - 72,324,843 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Gemin2
51 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	46
Count of miRNA genes:	36
Interacting mature miRNAs:	41
Transcripts:	ENSRNOT00000006137
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9590290	Uminl2	Urine mineral level QTL 2	3.96	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	6	44510974	89510974	Rat
2293088	Iddm28	Insulin dependent diabetes mellitus QTL 28	5.21		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	6	68767270	135411972	Rat
4889933	Bss88	Bone structure and strength QTL 88	3.8		tibia size trait (VT:0100001)	tibia total bone volume (CMO:0001724)	6	53684921	98684921	Rat
634307	Bp141	Blood pressure QTL 141	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	40957564	85957564	Rat
1331743	Uae28	Urinary albumin excretion QTL 28	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	45153786	90153786	Rat
5684992	Bmd83	Bone mineral density QTL 82	4.8		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	6	53684921	98684921	Rat
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	71278722	116278722	Rat
70176	Mcsm1	Mammary carcinoma susceptibility modifier QTL 1			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	64367996	109367996	Rat
1558641	Cm47	Cardiac mass QTL 47	2.9	0.001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	6	63457441	94939581	Rat
724524	Uae2	Urinary albumin excretion QTL 2	2.7	0.0005	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	79198463	144254945	Rat
737827	Hcar11	Hepatocarcinoma resistance QTL 11	4.4		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	6	46050607	116278722	Rat
724513	Uae14	Urinary albumin excretion QTL 14	6.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	46047353	91047353	Rat
2293839	Kiddil2	Kidney dilation QTL 2	4.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	26618314	86868070	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	20859430	113082285	Rat
9590140	Scort4	Serum corticosterone level QTL 4	14.49	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	44510974	89510974	Rat
2301964	Bp323	Blood pressure QTL 323	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	1	86868070	Rat
9590306	Scort18	Serum corticosterone level QTL 18	2.88	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	44510974	89510974	Rat
2293841	Kiddil4	Kidney dilation QTL 4	4.4		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	26618314	86868070	Rat
4889848	Pur25	Proteinuria QTL 25	14	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	63037319	95934232	Rat
6893340	Cm77	Cardiac mass QTL 77	0.26	0.57	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	39028659	86867923	Rat
5684963	Bss99	Bone structure and strength QTL 99	3.1		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	6	53684921	98684921	Rat
1576302	Schws4	Schwannoma susceptibility QTL 4		0.0078	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	78204640	123204640	Rat
1300075	Glom7	Glomerulus QTL 7	5.6	0.0000002	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	6	76937178	121937178	Rat
1300143	Rf14	Renal function QTL 14	2.92		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	40163183	85163183	Rat
6893332	Cm74	Cardiac mass QTL 74	0.4	0.64	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	63457441	94939581	Rat

Markers in Region

RH133890

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	6	82,455,855 - 82,456,045 (+)	Marker Load Pipeline
mRatBN7.2	6	76,720,959 - 76,721,149 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	80,122,188 - 80,122,377	NCBI	Rnor6.0
Rnor_5.0	6	89,648,060 - 89,648,249	UniSTS	Rnor5.0
RGSC_v3.4	6	79,721,850 - 79,722,039	UniSTS	RGSC3.4
Celera	6	75,481,244 - 75,481,433	UniSTS
RH 3.4 Map	6	545.6	UniSTS
Cytogenetic Map	6	q23	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053389	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039113002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039113003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005505592	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC079389	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF176072	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC098662	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000006137 ⟹ ENSRNOP00000006137

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	82,442,350 - 82,456,048 (+)	Ensembl
mRatBN7.2 Ensembl	6	76,707,523 - 76,721,153 (+)	Ensembl
Rnor_6.0 Ensembl	6	80,108,655 - 80,122,365 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000151622 ⟹ ENSRNOP00000112262

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	82,442,350 - 82,456,048 (+)	Ensembl

RefSeq Acc Id:

NM_053389 ⟹ NP_445841

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	82,442,419 - 82,456,050 (+)	NCBI
mRatBN7.2	6	76,707,523 - 76,721,154 (+)	NCBI
Rnor_6.0	6	80,108,751 - 80,122,382 (+)	NCBI
Rnor_5.0	6	89,634,623 - 89,648,254 (+)	NCBI
RGSC_v3.4	6	79,708,413 - 79,722,044 (+)	RGD
Celera	6	75,467,807 - 75,481,438 (+)	RGD

Sequence:

show sequence

GCGACGGAGGGCGCTTGAGCGCCTGCGCGGTACCTACCTTGGGTACAGGCGCCAATAGAGACTG
GCGGGAGTAAATACCATGGCGTGGGTTCCAGCCGAGTCTGCGGTGGAAGAGTTGATGCCACGGT
TGTTACCTGTGGAGCCCTGTGACTTGACGGAAGGTTTCGATCCCTCGGTACCCCCCAGGACGCC
TCAGGAATACCTGAGGAGGGTGCAGATCGAAGCAGCCCAGTGTCCAGATGTTGTGGTAGCCCAG
ATTGACCCAAAGAAGTTGAAAAGGAAGCAAAGTGTGAATGTTTCTCTTTCGGGATGCCACCCTG
CCCCTGAAGGTTATTCCCCAACACTGCAGTGGCAGCAGCAACAAGTGATACAGTTTTCGAGTGT
TCGACAGAGTGTGCACAAGCATAGAAATCACTGGAAATCTCAACAGTTGGATAGTAATGTGACA
ATGCCAAAATCTGAAGATGAAGAAGGCTGGAAAAAATTTTGTCTGGGTGAAAGATTATGTGCTG
AAGGGGCTACTGGACCATCTACAGACGAAAGCCCTGGGATTGATTATGTACAAGTTGGTTTTCC
TCCCTTGCTGAGTATTGTAAGCAGAATGAATCAGGCAACCATTACTAGTGTCTTGGAATATCTA
AGTAATTGGTTTGGAGAAAGAGATTTTACTCCAGAATTGGGAAGATGGTTCTATGCTTTGTTGG
CTTGTCTTGAGAAACCTTTGCTACCTGAGGCTCACTCACTGATTCGACAGCTTGCCAGAAGGTG
TTCTGAAGTGAGGCTCCTGGTGGGCAGTAAAGACGATGAAAGAGTTCCAGCTTTGAATCTGCTG
ATCTGCTTAGTTAGCAGGTATTTTGATCAACGTGATTTAGCTGATGAGCCATCTTGATAGAGCT
TACCTCCTGGGGATGGAAGAGAGTTCTGTGAAGGGAGCCTAAGTCTGAGGAAGCATAATTCCAA
CCTGAGGACAGAGTGCATCACTTCTTCAAGTTGTGTGAAGGGTTTCATCTTAATCTGCAATTCA
AGTTGATATTCAAAATATAGACTTGATTGGTTTAAGTGTCTGAAATGTCTACGGAAAGCCCACC
TGGCATCTGATGAGCAGTTGGAACAGTTTTCCTCAGTTGCATGCATTGAAAATAGGCCACGTGG
GACTTAGTACTTAAGCGGCTTGCATAAAAACTGCTGACATTTTATACAGTCCCCTGGTGCTGCT
TCATTGGTTTTTTACAATATACATATATATTTATGTTGAAATGTATTTTGACTACTCAAATTTT
ACTTGACTCAAACAAAATAAAAGACAATGGATGTCCTTAGAGTTGCAATTCAAAAAAAAAAAAA
AAAAAA

hide sequence

RefSeq Acc Id:

XM_039113002 ⟹ XP_038968930

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	82,442,576 - 82,456,050 (+)	NCBI
mRatBN7.2	6	76,707,526 - 76,721,154 (+)	NCBI

RefSeq Acc Id:

XM_039113003 ⟹ XP_038968931

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	82,442,441 - 82,456,050 (+)	NCBI
mRatBN7.2	6	76,707,529 - 76,721,154 (+)	NCBI

RefSeq Acc Id:

XR_005505592

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	82,442,498 - 82,452,209 (+)	NCBI
mRatBN7.2	6	76,706,424 - 76,721,154 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_445841	(Get FASTA)	NCBI Sequence Viewer
	XP_038968930	(Get FASTA)	NCBI Sequence Viewer
	XP_038968931	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD53287	(Get FASTA)	NCBI Sequence Viewer
	AAH98662	(Get FASTA)	NCBI Sequence Viewer
	EDM03464	(Get FASTA)	NCBI Sequence Viewer
	EDM03465	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000006137
	ENSRNOP00000006137.4
GenBank Protein	Q9QZP1	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_445841 ⟸ NM_053389

- UniProtKB:

Q4G084 (UniProtKB/Swiss-Prot), Q9QZP1 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MAWVPAESAVEELMPRLLPVEPCDLTEGFDPSVPPRTPQEYLRRVQIEAAQCPDVVVAQIDPKK
LKRKQSVNVSLSGCHPAPEGYSPTLQWQQQQVIQFSSVRQSVHKHRNHWKSQQLDSNVTMPKSE
DEEGWKKFCLGERLCAEGATGPSTDESPGIDYVQVGFPPLLSIVSRMNQATITSVLEYLSNWFG
ERDFTPELGRWFYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVGSKDDERVPALNLLICLVS
RYFDQRDLADEPS

hide sequence

Ensembl Acc Id:

ENSRNOP00000006137 ⟸ ENSRNOT00000006137

RefSeq Acc Id:	XP_038968930 ⟸ XM_039113002
- Peptide Label:	isoform X1
- UniProtKB:	A6HBQ9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038968931 ⟸ XM_039113003
- Peptide Label:	isoform X1
- UniProtKB:	A6HBQ9 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000112262 ⟸ ENSRNOT00000151622

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9QZP1-F1-model_v2	AlphaFold	Q9QZP1	1-269	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694614

Promoter ID:

EPDNEW_R5139

Type:

initiation region

Name:

Gemin2_1

Description:

gem associated protein 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	80,108,728 - 80,108,788	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620842	AgrOrtholog
BioCyc Gene	G2FUF-37388	BioCyc
Ensembl Genes	ENSRNOG00000004360	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000006137	ENTREZGENE
	ENSRNOT00000006137.6	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.5.220	UniProtKB/Swiss-Prot
	1.20.58.1070	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7386123	IMAGE-MGC_LOAD
InterPro	GEMIN2	UniProtKB/Swiss-Prot
	Gemin2/Brr1	UniProtKB/Swiss-Prot
KEGG Report	rno:84404	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:112609	IMAGE-MGC_LOAD
NCBI Gene	84404	ENTREZGENE
PANTHER	GEM-ASSOCIATED PROTEIN 2	UniProtKB/Swiss-Prot
	GEMIN2	UniProtKB/Swiss-Prot
Pfam	SIP1	UniProtKB/Swiss-Prot
PhenoGen	Gemin2	PhenoGen
PIRSF	SMN_Gemin2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000004360	RatGTEx
UniProt	A0ABK0M068_RAT	UniProtKB/TrEMBL
	A6HBQ9	ENTREZGENE, UniProtKB/TrEMBL
	GEMI2_RAT	UniProtKB/Swiss-Prot
	Q4G084	ENTREZGENE
	Q9QZP1	ENTREZGENE
UniProt Secondary	Q4G084	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-18	Gemin2	gem (nuclear organelle) associated protein 2	Sip1	survival of motor neuron protein interacting protein 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Sip1	survival of motor neuron protein interacting protein 1			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Sip1	survival of motor neuron protein interacting protein 1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message