Gpr173 (G-protein coupled receptor 173)

Gene: Gpr173 (G-protein coupled receptor 173) Rattus norvegicus

Analyze

Symbol:

Gpr173

Name:

G-protein coupled receptor 173

RGD ID:

620748

Description:

Predicted to enable gonadotropin-releasing hormone receptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway and cellular response to gonadotropin-releasing hormone. Predicted to act upstream of or within negative regulation of neuron migration. Predicted to be active in plasma membrane. Orthologous to human GPR173 (G protein-coupled receptor 173); INTERACTS WITH ammonium chloride; bisphenol A; vinclozolin.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

hypothetical protein LOC685576; LOC102555688; LOC685576; probable G-protein coupled receptor 173; probable G-protein coupled receptor 173-like; Sreb3; super conserved receptor expressed in brain 3

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GPR173 (G protein-coupled receptor 173)	HGNC	HomoloGene, NCBI, Panther
Mus musculus (house mouse):	Gpr173 (G-protein coupled receptor 173)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gpr173 (G protein-coupled receptor 173)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GPR173 (G protein-coupled receptor 173)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GPR173 (G protein-coupled receptor 173)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gpr173 (G protein-coupled receptor 173)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GPR173 (G protein-coupled receptor 173)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GPR173 (G protein-coupled receptor 173)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gpr173 (G protein-coupled receptor 173)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	GPR173 (G protein-coupled receptor 173)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gpr173 (G-protein coupled receptor 173)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gpr173 (G protein-coupled receptor 173)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gpr173	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	24,925,634 - 24,950,485 (-)	NCBI		GRCr8
mRatBN7.2	X	21,446,261 - 21,471,119 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	21,447,361 - 21,471,498 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	X	18,914,539 - 18,915,660 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	21,207,908 - 21,209,029 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	22,014,735 - 22,015,856 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	22,417,753 - 22,418,873 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	22,417,753 - 22,418,873 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	X	64,162,930 - 64,164,050 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	X	41,846,307 - 41,847,429 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	X	41,899,775 - 41,900,898 (-)	NCBI
Celera	X	21,710,846 - 21,711,967 (-)	NCBI		Celera
Cytogenetic Map	X	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autistic disorder (ISO)

genetic disease (ISO)

syndromic X-linked intellectual disability Lubs type (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

dichloroacetic acid (ISO)

dorsomorphin (ISO)

entinostat (ISO)

hexadecanoic acid (ISO)

lead(0) (ISO)

lipopolysaccharide (ISO)

panobinostat (ISO)

paracetamol (ISO)

phenylmercury acetate (ISO)

propanal (ISO)

quercitrin (ISO)

resveratrol (ISO)

SB 431542 (ISO)

silver atom (ISO)

silver(0) (ISO)

sunitinib (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to gonadotropin-releasing hormone (IEA)

G protein-coupled receptor signaling pathway (IEA)

negative regulation of neuron migration (ISO)

Cellular Component

plasma membrane (IBA,IEA)

Molecular Function

G protein-coupled receptor activity (IEA)

gonadotropin-releasing hormone receptor activity (IBA,IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	An evolutionarily conserved G-protein coupled receptor family, SREB, expressed in the central nervous system.	Matsumoto M, etal., Biochem Biophys Res Commun 2000 Jun 7;272(2):576-82.
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:23321696	PMID:27440717	PMID:32505354

Genomics

Comparative Map Data

Gpr173
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	24,925,634 - 24,950,485 (-)	NCBI		GRCr8
mRatBN7.2	X	21,446,261 - 21,471,119 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	21,447,361 - 21,471,498 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	X	18,914,539 - 18,915,660 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	21,207,908 - 21,209,029 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	22,014,735 - 22,015,856 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	22,417,753 - 22,418,873 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	22,417,753 - 22,418,873 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	X	64,162,930 - 64,164,050 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	X	41,846,307 - 41,847,429 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	X	41,899,775 - 41,900,898 (-)	NCBI
Celera	X	21,710,846 - 21,711,967 (-)	NCBI		Celera
Cytogenetic Map	X	q13	NCBI

GPR173
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	X	53,048,789 - 53,080,615 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	X	53,048,789 - 53,080,615 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	X	53,077,971 - 53,109,797 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	X	53,095,231 - 53,123,968 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	X	52,961,526 - 52,990,263	NCBI
Celera	X	56,934,390 - 56,936,128 (+)	NCBI		Celera
Cytogenetic Map	X	p11.22	NCBI
HuRef	X	50,140,776 - 50,196,313 (+)	NCBI		HuRef
CHM1_1	X	53,068,643 - 53,099,921 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	X	52,333,387 - 52,366,851 (+)	NCBI		T2T-CHM13v2.0

Gpr173
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	X	151,126,594 - 151,151,763 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	X	151,126,594 - 151,151,700 (-)	Ensembl		GRCm39 Ensembl
GRCm38	X	152,343,598 - 152,368,736 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	X	152,343,598 - 152,368,704 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	X	148,779,189 - 148,802,654 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	X	147,685,362 - 147,708,827 (-)	NCBI		MGSCv36	mm8
MGSCv36	X	129,353,131 - 129,376,480 (-)	NCBI		MGSCv36	mm8
Cytogenetic Map	X	F3	NCBI
cM Map	X	68.46	NCBI

Gpr173
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955475	137,239 - 158,670 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955475	137,239 - 158,670 (+)	NCBI	ChiLan1.0	ChiLan1.0

GPR173
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	X	54,447,458 - 54,476,980 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	X	54,451,071 - 54,478,016 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	X	45,262,876 - 45,292,398 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	X	53,372,577 - 53,399,278 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	X	53,397,890 - 53,399,011 (+)	Ensembl	panpan1.1		panPan2

GPR173
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	X	45,009,157 - 45,033,188 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	X	45,012,005 - 45,013,126 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	X	36,397,385 - 36,421,386 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	X	45,188,643 - 45,212,657 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	X	45,189,180 - 45,212,652 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	X	44,683,879 - 44,707,885 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	X	45,133,531 - 45,157,538 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	X	45,201,132 - 45,224,858 (+)	NCBI		UU_Cfam_GSD_1.0

Gpr173
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	X	37,721,834 - 37,741,529 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936751	61,936 - 81,254 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936751	61,770 - 82,769 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GPR173
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	X	45,883,767 - 45,908,537 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	X	45,883,738 - 45,908,197 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	X	51,383,702 - 51,408,183 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GPR173
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	X	49,185,372 - 49,217,506 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	X	49,213,513 - 49,214,631 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666086	3,137,575 - 3,169,537 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gpr173
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624909	297,374 - 320,729 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624909	297,324 - 320,731 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Gpr173
69 total Variants

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
731181	Uae27	Urinary albumin excretion QTL 27	2.7	0.0059	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	X	1	43491017	Rat
70165	Bp64	Blood pressure QTL 64	5.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	X	1448129	31706553	Rat
631204	Gluco15	Glucose level QTL 15		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	X	1623715	22646544	Rat
1298071	Edpm12	Estrogen-dependent pituitary mass QTL 12	3.2		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	X	2927898	47927898	Rat
10755455	Coatc13	Coat color QTL 13		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	4406000	49406000	Rat
631666	Iddm5	Insulin dependent diabetes mellitus QTL 5			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	X	4494549	49494549	Rat
61430	Cia18	Collagen induced arthritis QTL 18	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	X	14843113	120568734	Rat
71116	Niddm16	Non-insulin dependent diabetes mellitus QTL 16	7.81		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	X	15297802	60297802	Rat
1598873	Memor2	Memory QTL 2	2.5		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	X	20990947	41052531	Rat
2290375	Gluco34	Glucose level QTL 34	2.75		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	X	20990947	41203591	Rat

Markers in Region

GPR173_9777

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	X	21,449,637 - 21,449,749 (+)	MAPPER	mRatBN7.2
mRatBN7.2	X	21,448,866 - 21,449,749 (+)	MAPPER	mRatBN7.2
mRatBN7.2	X	21,448,866 - 21,450,366 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	22,417,503 - 22,418,384	NCBI	Rnor6.0
Rnor_6.0	X	22,417,503 - 22,419,112	NCBI	Rnor6.0
Rnor_5.0	X	64,162,690 - 64,164,300	NCBI	Rnor5.0
RGSC_v3.4	X	41,846,057 - 41,846,940	UniSTS	RGSC3.4
Celera	X	21,710,595 - 21,711,478	UniSTS
Cytogenetic Map	X	q21	UniSTS

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022255	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB040804	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474063	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000079982 ⟹ ENSRNOP00000096581

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	X	21,447,361 - 21,471,105 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000088630

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	X	21,449,227 - 21,471,498 (-)	Ensembl
Rnor_6.0 Ensembl	X	22,417,753 - 22,418,873 (-)	Ensembl

RefSeq Acc Id:

NM_022255 ⟹ NP_071591

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	24,925,634 - 24,950,485 (-)	NCBI
mRatBN7.2	X	21,446,261 - 21,471,119 (-)	NCBI
Rnor_6.0	X	22,417,753 - 22,418,873 (-)	NCBI
Rnor_5.0	X	64,162,930 - 64,164,050 (+)	NCBI
RGSC_v3.4	X	41,846,307 - 41,847,429 (-)	RGD
Celera	X	21,710,846 - 21,711,967 (-)	RGD

Sequence:

show sequence

ATGGCCAACACCACCGGAGAGCCCGAAGAGGTGAGCGGCGCACTGTCCCTGCCATCAGCATCGG
CTTATGTGAAGCTGGTGCTGCTGGGACTGATCATGTGTGTAAGCCTGGCAGGCAATGCCATCTT
GTCCCTGCTGGTGCTCAAGGAGCGTGCCCTGCACAAGGCTCCTTACTACTTTCTGCTGGACCTG
TGCCTAGCCGATGGCATACGCTCTGCCATCTGCTTCCCCTTTGTACTGGCTTCTGTGCGCCATG
GCTCCTCGTGGACCTTCAGTGCACTCAGCTGTAAGATTGTGGCCTTTATGGCTGTGCTCTTTTG
CTTCCATGCGGCCTTCATGCTGTTCTGCATCAGCGTCACCCGCTACATGGCCATCGCCCACCAC
CGCTTCTATGCCAAGCGCATGACACTCTGGACATGCGCAGCTGTCATCTGCATGGCCTGGACCT
TGTCTGTGGCCATGGCTTTCCCACCTGTCTTTGATGTGGGCACCTACAAGTTTATCCGAGAGGA
GGACCAGTGCATCTTTGAGCATCGCTACTTCAAAGCAAATGACACTCTGGGCTTTATGCTTATG
TTGGCTGTGCTCATGGCAGCCACACATGCTGTCTATGGCAAGCTGCTACTCTTCGAGTATCGTC
ACCGCAAGATGAAGCCAGTGCAGATGGTGCCCGCCATCAGCCAAAACTGGACATTCCATGGCCC
TGGGGCTACCGGCCAGGCTGCTGCCAACTGGATCGCTGGCTTTGGCCGTGGGCCCATGCCACCA
ACTCTGCTGGGTATCCGGCAGAATGGGCATGCAGCTAGCCGGCGGCTACTGGGCATGGACGAGG
TCAAGGGTGAAAAGCAGCTGGGCCGAATGTTCTACGCGATTACACTGCTCTTCCTGCTCCTCTG
GTCACCATACATTGTGGCCTGCTACTGGCGAGTGTTTGTGAAAGCCTGCGCTGTGCCCCACCGC
TACCTGGCCACTGCTGTTTGGATGAGCTTCGCCCAGGCTGCTGTCAACCCAATCGTCTGCTTCC
TGCTTAACAAGGACCTCAAGAAGTGCCTGAGGACTCATGCCCCTTGCTGGGGCACAGGAGGTGC
CCCAGCTCCCAGAGAACCCTACTGTGTCATGTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_071591	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAA96650	(Get FASTA)	NCBI Sequence Viewer
	EDL86297	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000092248
	ENSRNOP00000092248.1
	ENSRNOP00000096581.1
	ENSRNOP00055031382
	ENSRNOP00060036412
	ENSRNOP00065032239
GenBank Protein	Q9JJH2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_071591 ⟸ NM_022255

- UniProtKB:

Q9JJH2 (UniProtKB/Swiss-Prot), A6KLC3 (UniProtKB/TrEMBL), A0A8I6AH63 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MANTTGEPEEVSGALSLPSASAYVKLVLLGLIMCVSLAGNAILSLLVLKERALHKAPYYFLLDL
CLADGIRSAICFPFVLASVRHGSSWTFSALSCKIVAFMAVLFCFHAAFMLFCISVTRYMAIAHH
RFYAKRMTLWTCAAVICMAWTLSVAMAFPPVFDVGTYKFIREEDQCIFEHRYFKANDTLGFMLM
LAVLMAATHAVYGKLLLFEYRHRKMKPVQMVPAISQNWTFHGPGATGQAAANWIAGFGRGPMPP
TLLGIRQNGHAASRRLLGMDEVKGEKQLGRMFYAITLLFLLLWSPYIVACYWRVFVKACAVPHR
YLATAVWMSFAQAAVNPIVCFLLNKDLKKCLRTHAPCWGTGGAPAPREPYCVM

hide sequence

RefSeq Acc Id:

ENSRNOP00000096581 ⟸ ENSRNOT00000079982

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2K5Q7-F1-model_v2	AlphaFold	A0A0G2K5Q7	1-117	view protein structure
AF-Q9JJH2-F1-model_v2	AlphaFold	Q9JJH2	1-373	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620748	AgrOrtholog
BioCyc Gene	G2FUF-2712	BioCyc
Ensembl Genes	ENSRNOG00000057658	Ensembl
	ENSRNOG00000060137	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055022478	UniProtKB/Swiss-Prot
	ENSRNOG00060025350	UniProtKB/Swiss-Prot
	ENSRNOG00065023218	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000079982.2	UniProtKB/Swiss-Prot
	ENSRNOT00000088630	ENTREZGENE
	ENSRNOT00000088630.2	UniProtKB/TrEMBL
	ENSRNOT00055038633	UniProtKB/Swiss-Prot
	ENSRNOT00060043878	UniProtKB/Swiss-Prot
	ENSRNOT00065039648	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:64021	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	64021	ENTREZGENE
PANTHER	G PROTEIN-COUPLED RECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G-PROTEIN COUPLED RECEPTOR 173-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	7tm_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Gpr173	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000057658	RatGTEx
	ENSRNOG00000060137	RatGTEx
	ENSRNOG00055022478	RatGTEx
	ENSRNOG00060025350	RatGTEx
	ENSRNOG00065023218	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6AH63	ENTREZGENE, UniProtKB/TrEMBL
	A6KLC3	ENTREZGENE, UniProtKB/TrEMBL
	GP173_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Gpr173	G-protein coupled receptor 173	LOC102555688	probable G-protein coupled receptor 173-like	Data merged from RGD:7675934	737654	PROVISIONAL
2015-07-29	LOC102555688	probable G-protein coupled receptor 173-like	LOC685576	hypothetical protein LOC685576	Data merged from RGD:1592572	737654	PROVISIONAL
2013-12-18	LOC102555688	probable G-protein coupled receptor 173-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-01-09	LOC685576	hypothetical protein LOC685576	LOC684078	hypothetical protein LOC684078	Data merged from RGD:1595169	1643240	APPROVED
2006-11-20	LOC685576	hypothetical protein LOC685576			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-20	LOC684078	hypothetical protein LOC684078			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-03-30	Gpr173	G-protein coupled receptor 173	Sreb3		Symbol updated	1299863	APPROVED
2005-01-20	Sreb3	G-protein coupled receptor 173		SREB3	Name updated	1299863	APPROVED
2002-08-07	Sreb3	SREB3			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar