Symbol:
Bmp1
Name:
bone morphogenetic protein 1
RGD ID:
620739
Description:
Predicted to enable identical protein binding activity and metalloendopeptidase activity. Predicted to be involved in dorsal/ventral pattern formation and protein processing. Predicted to act upstream of or within positive regulation of cartilage development. Located in extracellular space and vesicle. Human ortholog(s) of this gene implicated in osteogenesis imperfecta type 13. Orthologous to human BMP1 (bone morphogenetic protein 1); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
bone morphogenetic protein 1 (procollagen C-proteinase); procollagen C-proteinase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
BMP1 (bone morphogenetic protein 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Bmp1 (bone morphogenetic protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Bmp1 (bone morphogenetic protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
BMP1 (bone morphogenetic protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
BMP1 (bone morphogenetic protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Bmp1 (bone morphogenetic protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
BMP1 (bone morphogenetic protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
BMP1 (bone morphogenetic protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Bmp1 (bone morphogenetic protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Bmp1 (bone morphogenetic protein 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
BMP1 (bone morphogenetic protein 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
bmp1a (bone morphogenetic protein 1a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
bmp1b (bone morphogenetic protein 1b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
nas-39
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
tld
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
tok
Alliance
DIOPT (Hieranoid|InParanoid|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
bmp1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 51,961,310 - 52,005,597 (-) NCBI GRCr8 mRatBN7.2 15 45,551,603 - 45,595,862 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 45,551,603 - 45,595,776 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 49,669,483 - 49,713,645 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 50,780,998 - 50,825,151 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 47,640,279 - 47,684,442 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 52,166,401 - 52,210,786 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 52,166,401 - 52,210,746 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 55,889,918 - 55,934,263 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 50,878,144 - 50,922,313 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 50,910,779 - 50,923,437 (-) NCBI Celera 15 45,230,611 - 45,274,179 (-) NCBI Celera Cytogenetic Map 15 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Bmp1 Rat (1->4)-beta-D-glucan multiple interactions ISO Bmp1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of BMP1 mRNA CTD PMID:36331819 Bmp1 Rat 1,1-dichloroethene increases expression ISO Bmp1 (Mus musculus) 6480464 vinylidene chloride results in increased expression of BMP1 mRNA CTD PMID:26682919 Bmp1 Rat 1,2-dimethylhydrazine increases expression ISO Bmp1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of BMP1 mRNA CTD PMID:22206623 Bmp1 Rat 17alpha-ethynylestradiol increases expression ISO Bmp1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of BMP1 mRNA CTD PMID:17942748 Bmp1 Rat 17alpha-ethynylestradiol multiple interactions ISO Bmp1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of BMP1 mRNA CTD PMID:17942748 Bmp1 Rat 17beta-estradiol increases expression ISO Bmp1 (Mus musculus) 6480464 Estradiol results in increased expression of BMP1 mRNA CTD PMID:19484750 and PMID:39298647 Bmp1 Rat 17beta-estradiol multiple interactions ISO BMP1 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of BMP1 mRNA CTD PMID:30165855 Bmp1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl affects expression ISO BMP1 (Homo sapiens) 6480464 2 more ... CTD PMID:20638727 Bmp1 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:27291303 Bmp1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Bmp1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of BMP1 mRNA CTD PMID:17942748 Bmp1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of BMP1 mRNA CTD PMID:34747641 Bmp1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Bmp1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of BMP1 mRNA CTD PMID:26290441 Bmp1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Bmp1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of BMP1 mRNA CTD PMID:21570461 Bmp1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Bmp1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of BMP1 mRNA CTD PMID:17942748 Bmp1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Bmp1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Bmp1 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Bmp1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of BMP1 mRNA CTD PMID:20188158 Bmp1 Rat 4,4'-sulfonyldiphenol increases expression ISO Bmp1 (Mus musculus) 6480464 bisphenol S results in increased expression of BMP1 mRNA CTD PMID:39298647 Bmp1 Rat 4-(ethoxymethylene)-2-phenyloxazol-5-one increases expression ISO Bmp1 (Mus musculus) 6480464 Oxazolone results in increased expression of BMP1 mRNA CTD PMID:11379042 Bmp1 Rat 4-hydroxynon-2-enal decreases expression ISO BMP1 (Homo sapiens) 6480464 4-hydroxy-2-nonenal results in decreased expression of BMP1 mRNA CTD PMID:12419474 Bmp1 Rat 4-hydroxyphenyl retinamide decreases expression ISO Bmp1 (Mus musculus) 6480464 Fenretinide results in decreased expression of BMP1 mRNA CTD PMID:28973697 Bmp1 Rat 5-aza-2'-deoxycytidine increases expression ISO Bmp1 (Mus musculus) 6480464 Decitabine results in increased expression of BMP1 mRNA CTD PMID:27915011 Bmp1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of BMP1 mRNA CTD PMID:24780913 and PMID:36843608 Bmp1 Rat acrolein multiple interactions ISO BMP1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of BMP1 mRNA more ... CTD PMID:32699268 and PMID:32845096 Bmp1 Rat all-trans-retinoic acid increases expression ISO Bmp1 (Mus musculus) 6480464 Tretinoin results in increased expression of BMP1 mRNA CTD PMID:16604517 Bmp1 Rat alpha-pinene multiple interactions ISO BMP1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of BMP1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of BMP1 mRNA CTD PMID:32699268 Bmp1 Rat aluminium oxide increases expression ISO BMP1 (Homo sapiens) 6480464 Aluminum Oxide results in increased expression of BMP1 mRNA CTD PMID:19464052 Bmp1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of BMP1 mRNA CTD PMID:16483693 Bmp1 Rat arsane multiple interactions ISO BMP1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of BMP1 mRNA CTD PMID:39836092 Bmp1 Rat arsenic atom multiple interactions ISO BMP1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of BMP1 mRNA CTD PMID:39836092 Bmp1 Rat arsenite(3-) decreases expression ISO Bmp1 (Mus musculus) 6480464 arsenite results in decreased expression of BMP1 mRNA CTD PMID:33053406 Bmp1 Rat astemizole decreases expression EXP 6480464 Astemizole results in decreased expression of BMP1 mRNA CTD PMID:20221588 Bmp1 Rat Azoxymethane multiple interactions ISO Bmp1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of BMP1 mRNA CTD PMID:29950665 Bmp1 Rat bacitracin increases expression EXP 6480464 Bacitracin results in increased expression of BMP1 mRNA CTD PMID:18289764 Bmp1 Rat benzo[a]pyrene decreases expression ISO Bmp1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of BMP1 mRNA CTD PMID:19770486 Bmp1 Rat benzo[a]pyrene increases expression ISO BMP1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of BMP1 mRNA CTD PMID:32234424 Bmp1 Rat benzo[a]pyrene increases methylation ISO BMP1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of BMP1 promoter CTD PMID:27901495 Bmp1 Rat benzo[a]pyrene decreases methylation ISO Bmp1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of BMP1 promoter CTD PMID:28476633 Bmp1 Rat benzo[a]pyrene increases expression ISO Bmp1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of BMP1 mRNA CTD PMID:22228805 Bmp1 Rat beta-lapachone decreases expression ISO BMP1 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of BMP1 mRNA CTD PMID:38218311 Bmp1 Rat bis(2-chloroethyl) sulfide decreases expression ISO Bmp1 (Mus musculus) 6480464 Mustard Gas results in decreased expression of BMP1 mRNA CTD PMID:15674843 Bmp1 Rat bis(2-ethylhexyl) phthalate increases expression ISO BMP1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of BMP1 mRNA CTD PMID:31163220 Bmp1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Bmp1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of BMP1 mRNA CTD PMID:33754040 Bmp1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of BMP1 mRNA CTD PMID:25181051 Bmp1 Rat bisphenol A decreases methylation ISO BMP1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of BMP1 gene CTD PMID:31601247 Bmp1 Rat bisphenol A increases expression ISO Bmp1 (Mus musculus) 6480464 bisphenol A results in increased expression of BMP1 mRNA CTD PMID:34585602 Bmp1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of BMP1 mRNA CTD PMID:34947998 Bmp1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of BMP1 gene CTD PMID:28505145 Bmp1 Rat butanal decreases expression ISO BMP1 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of BMP1 mRNA CTD PMID:26079696 Bmp1 Rat calciol increases expression ISO Bmp1 (Mus musculus) 6480464 Cholecalciferol results in increased expression of BMP1 mRNA CTD PMID:17170073 Bmp1 Rat carbon nanotube increases expression ISO Bmp1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Bmp1 Rat chlordecone increases expression ISO Bmp1 (Mus musculus) 6480464 Chlordecone results in increased expression of BMP1 mRNA CTD PMID:33711761 Bmp1 Rat chloroprene increases expression EXP 6480464 Chloroprene results in increased expression of BMP1 mRNA CTD PMID:23125180 Bmp1 Rat chromium(6+) affects expression ISO Bmp1 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of BMP1 mRNA CTD PMID:28472532 Bmp1 Rat cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of BMP1 mRNA CTD PMID:18289764 Bmp1 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of BMP1 mRNA CTD PMID:17602206 Bmp1 Rat clofibric acid affects expression EXP 6480464 Clofibric Acid affects the expression of BMP1 mRNA CTD PMID:17602206 Bmp1 Rat cobalt dichloride decreases expression ISO BMP1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of BMP1 mRNA CTD PMID:19376846 Bmp1 Rat copper atom multiple interactions ISO Bmp1 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of BMP1 mRNA CTD PMID:15467011 Bmp1 Rat copper(0) multiple interactions ISO Bmp1 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of BMP1 mRNA CTD PMID:15467011 Bmp1 Rat corn oil affects expression EXP 6480464 Corn Oil affects the expression of BMP1 mRNA CTD PMID:16360708 Bmp1 Rat cyclosporin A increases expression ISO Bmp1 (Mus musculus) 6480464 Cyclosporine results in increased expression of BMP1 mRNA CTD PMID:19770486 Bmp1 Rat DDE decreases expression ISO BMP1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of BMP1 mRNA CTD PMID:38568856 Bmp1 Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of BMP1 mRNA CTD PMID:23640034 Bmp1 Rat dextran sulfate multiple interactions ISO Bmp1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of BMP1 mRNA CTD PMID:29950665 Bmp1 Rat dibenzo[a,l]pyrene decreases methylation ISO Bmp1 (Mus musculus) 6480464 dibenzo(a and l)pyrene results in decreased methylation of BMP1 promoter CTD PMID:28476633 Bmp1 Rat dibutyl phthalate increases expression ISO Bmp1 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of BMP1 mRNA CTD PMID:21266533 Bmp1 Rat dimethylarsinic acid decreases expression ISO BMP1 (Homo sapiens) 6480464 Cacodylic Acid results in decreased expression of BMP1 mRNA CTD PMID:17720352 Bmp1 Rat doxorubicin increases expression ISO BMP1 (Homo sapiens) 6480464 Doxorubicin results in increased expression of BMP1 mRNA CTD PMID:29803840 Bmp1 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of BMP1 mRNA CTD PMID:29391264 Bmp1 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of BMP1 mRNA CTD PMID:23962444 Bmp1 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of BMP1 mRNA CTD PMID:24136188 Bmp1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of BMP1 mRNA CTD PMID:18289764 Bmp1 Rat glycerol 2-phosphate multiple interactions EXP 6480464 [Ascorbic Acid co-treated with beta-glycerophosphoric acid] results in increased expression of BMP1 mRNA CTD PMID:15994055 Bmp1 Rat graphene oxide increases expression ISO BMP1 (Homo sapiens) 6480464 graphene oxide results in increased expression of BMP1 protein CTD PMID:33219560 and PMID:33219569 Bmp1 Rat L-ascorbic acid multiple interactions EXP 6480464 [Ascorbic Acid co-treated with beta-glycerophosphoric acid] results in increased expression of BMP1 mRNA CTD PMID:15994055 Bmp1 Rat lead diacetate decreases expression ISO BMP1 (Homo sapiens) 6480464 lead acetate results in decreased expression of BMP1 mRNA CTD PMID:38568856 Bmp1 Rat methotrexate increases expression ISO BMP1 (Homo sapiens) 6480464 Methotrexate results in increased expression of BMP1 mRNA CTD PMID:21678067 Bmp1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of BMP1 mRNA CTD PMID:17602206 Bmp1 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of BMP1 mRNA CTD PMID:20360939 Bmp1 Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of BMP1 mRNA CTD PMID:24136188 Bmp1 Rat nickel atom increases expression ISO BMP1 (Homo sapiens) 6480464 Nickel results in increased expression of BMP1 mRNA CTD PMID:25583101 Bmp1 Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of BMP1 mRNA CTD PMID:24136188 Bmp1 Rat nitric oxide decreases expression ISO Bmp1 (Mus musculus) 6480464 Nitric Oxide deficiency results in decreased expression of BMP1 mRNA CTD PMID:15878706 Bmp1 Rat ozone multiple interactions ISO BMP1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of BMP1 mRNA more ... CTD PMID:32699268 and PMID:32845096 Bmp1 Rat ozone multiple interactions ISO Bmp1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of BMP1 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of BMP1 mRNA CTD PMID:34911549 Bmp1 Rat ozone increases expression ISO Bmp1 (Mus musculus) 6480464 Ozone results in increased expression of BMP1 mRNA CTD PMID:38897669 Bmp1 Rat paracetamol increases expression ISO BMP1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of BMP1 mRNA CTD PMID:22230336 Bmp1 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of BMP1 mRNA CTD PMID:32680482 Bmp1 Rat PCB138 decreases expression EXP 6480464 2 more ... CTD PMID:23829299 Bmp1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Bmp1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of BMP1 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of BMP1 mRNA CTD PMID:36331819 Bmp1 Rat phenytoin decreases expression ISO BMP1 (Homo sapiens) 6480464 Phenytoin results in decreased expression of BMP1 mRNA CTD PMID:14741686 Bmp1 Rat pirinixic acid increases expression ISO Bmp1 (Mus musculus) 6480464 pirinixic acid results in increased expression of BMP1 mRNA CTD PMID:18301758 Bmp1 Rat potassium chromate decreases expression ISO BMP1 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of BMP1 mRNA CTD PMID:22714537 Bmp1 Rat propiconazole decreases expression ISO Bmp1 (Mus musculus) 6480464 propiconazole results in decreased expression of BMP1 mRNA CTD PMID:21278054 Bmp1 Rat quercetin increases expression ISO BMP1 (Homo sapiens) 6480464 Quercetin results in increased expression of BMP1 mRNA CTD PMID:15309432 Bmp1 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of BMP1 mRNA CTD PMID:28374803 Bmp1 Rat S-butyl-DL-homocysteine (S,R)-sulfoximine decreases expression ISO Bmp1 (Mus musculus) 6480464 Buthionine Sulfoximine results in decreased expression of BMP1 mRNA CTD PMID:15878706 Bmp1 Rat simvastatin increases expression EXP 6480464 Simvastatin results in increased expression of BMP1 mRNA CTD PMID:12963647 Bmp1 Rat sodium arsenite decreases expression ISO BMP1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of BMP1 mRNA CTD PMID:38568856 Bmp1 Rat sodium arsenite multiple interactions ISO BMP1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of BMP1 mRNA CTD PMID:39836092 Bmp1 Rat Soman increases expression EXP 6480464 Soman results in increased expression of BMP1 mRNA CTD PMID:19281266 Bmp1 Rat sunitinib decreases expression ISO BMP1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of BMP1 mRNA CTD PMID:31533062 Bmp1 Rat tert-butyl hydroperoxide decreases expression ISO BMP1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of BMP1 mRNA CTD PMID:12419474 Bmp1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of BMP1 mRNA CTD PMID:34492290 Bmp1 Rat titanium dioxide multiple interactions ISO Bmp1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of BMP1 mRNA CTD PMID:29950665 Bmp1 Rat triclosan increases expression ISO BMP1 (Homo sapiens) 6480464 Triclosan results in increased expression of BMP1 mRNA CTD PMID:30510588 Bmp1 Rat tunicamycin decreases expression ISO Bmp1 (Mus musculus) 6480464 Tunicamycin results in decreased expression of BMP1 mRNA CTD PMID:17127020 Bmp1 Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of BMP1 mRNA CTD PMID:24136188 Bmp1 Rat valproic acid increases methylation ISO BMP1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of BMP1 gene CTD PMID:29154799 Bmp1 Rat valproic acid decreases expression ISO BMP1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of BMP1 mRNA CTD PMID:29154799 and PMID:29501571 Bmp1 Rat vancomycin increases expression EXP 6480464 Vancomycin results in increased expression of BMP1 mRNA CTD PMID:18289764 Bmp1 Rat zoledronic acid increases expression ISO BMP1 (Homo sapiens) 6480464 zoledronic acid results in increased expression of BMP1 mRNA CTD PMID:20977926
(1->4)-beta-D-glucan (ISO) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO) 4-hydroxynon-2-enal (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acrolein (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) aluminium oxide (ISO) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) astemizole (EXP) Azoxymethane (ISO) bacitracin (EXP) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) butanal (ISO) calciol (ISO) carbon nanotube (ISO) chlordecone (ISO) chloroprene (EXP) chromium(6+) (ISO) cisplatin (EXP) clofibric acid (EXP) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) corn oil (EXP) cyclosporin A (ISO) DDE (ISO) decabromodiphenyl ether (EXP) dextran sulfate (ISO) dibenzo[a,l]pyrene (ISO) dibutyl phthalate (ISO) dimethylarsinic acid (ISO) doxorubicin (ISO) endosulfan (EXP) fipronil (EXP) flutamide (EXP) gentamycin (EXP) glycerol 2-phosphate (EXP) graphene oxide (ISO) L-ascorbic acid (EXP) lead diacetate (ISO) methotrexate (ISO) N-nitrosodiethylamine (EXP) nefazodone (EXP) nickel atom (ISO) nimesulide (EXP) nitric oxide (ISO) ozone (ISO) paracetamol (ISO) paraquat (EXP) PCB138 (EXP) perfluorooctane-1-sulfonic acid (ISO) phenytoin (ISO) pirinixic acid (ISO) potassium chromate (ISO) propiconazole (ISO) quercetin (ISO) rotenone (EXP) S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO) simvastatin (EXP) sodium arsenite (ISO) Soman (EXP) sunitinib (ISO) tert-butyl hydroperoxide (ISO) thioacetamide (EXP) titanium dioxide (ISO) triclosan (ISO) tunicamycin (ISO) valdecoxib (EXP) valproic acid (ISO) vancomycin (EXP) zoledronic acid (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
4.
Matrix vesicles are carriers of bone morphogenetic proteins (BMPs), vascular endothelial growth factor (VEGF), and noncollagenous matrix proteins.
Nahar NN, etal., J Bone Miner Metab. 2008;26(5):514-9. Epub 2008 Aug 30.
5.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
7.
GOA pipeline
RGD automated data pipeline
8.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Tissue remodeling in the acute otitis media mouse model.
Sautter NB, etal., Int J Pediatr Otorhinolaryngol. 2011 Nov;75(11):1368-71. doi: 10.1016/j.ijporl.2011.07.026. Epub 2011 Sep 1.
Bmp1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 51,961,310 - 52,005,597 (-) NCBI GRCr8 mRatBN7.2 15 45,551,603 - 45,595,862 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 45,551,603 - 45,595,776 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 49,669,483 - 49,713,645 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 50,780,998 - 50,825,151 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 47,640,279 - 47,684,442 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 52,166,401 - 52,210,786 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 52,166,401 - 52,210,746 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 55,889,918 - 55,934,263 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 50,878,144 - 50,922,313 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 50,910,779 - 50,923,437 (-) NCBI Celera 15 45,230,611 - 45,274,179 (-) NCBI Celera Cytogenetic Map 15 p11 NCBI
BMP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 22,165,372 - 22,212,326 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 22,165,140 - 22,212,326 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 22,022,885 - 22,069,839 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 22,078,835 - 22,125,782 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 8 20,984,783 - 21,032,542 (+) NCBI Celera Cytogenetic Map 8 p21.3 NCBI HuRef 8 20,564,967 - 20,612,031 (+) NCBI HuRef CHM1_1 8 22,224,312 - 22,271,500 (+) NCBI CHM1_1 T2T-CHM13v2.0 8 22,439,316 - 22,486,280 (+) NCBI T2T-CHM13v2.0
Bmp1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 70,711,998 - 70,758,280 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 70,711,998 - 70,757,674 (-) Ensembl GRCm39 Ensembl GRCm38 14 70,474,555 - 70,520,716 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 70,474,558 - 70,520,234 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 70,874,362 - 70,920,067 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 69,209,638 - 69,255,268 (-) NCBI MGSCv36 mm8 Celera 14 68,015,981 - 68,061,716 (-) NCBI Celera Cytogenetic Map 14 D2 NCBI cM Map 14 36.32 NCBI
Bmp1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955403 45,660,588 - 45,693,724 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955403 45,660,591 - 45,693,724 (+) NCBI ChiLan1.0 ChiLan1.0
BMP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 40,666,831 - 40,714,042 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 16,392,228 - 16,439,248 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 21,410,139 - 21,457,144 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 18,349,836 - 18,396,796 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 8 18,349,836 - 18,396,796 (+) Ensembl panpan1.1 panPan2
BMP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 25 35,043,594 - 35,087,282 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 25 35,020,751 - 35,087,545 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 25 35,633,298 - 35,676,927 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 25 35,255,039 - 35,298,679 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 25 35,255,044 - 35,298,662 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 25 35,200,533 - 35,244,157 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 25 35,055,062 - 35,098,676 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 25 35,210,570 - 35,254,197 (-) NCBI UU_Cfam_GSD_1.0
Bmp1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404943 12,546,649 - 12,579,706 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936555 5,990,836 - 6,023,878 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936555 5,990,822 - 6,023,864 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
BMP1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 6,443,912 - 6,489,063 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 6,443,773 - 6,489,066 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 6,881,220 - 6,923,093 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BMP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 8 20,234,242 - 20,281,768 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 8 20,234,184 - 20,283,467 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666052 21,954,309 - 22,001,797 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Bmp1
.
Predicted Target Of
Count of predictions: 195 Count of miRNA genes: 122 Interacting mature miRNAs: 141 Transcripts: ENSRNOT00000046054 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331729 Rf42 Renal function QTL 42 3.071 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 15 17362897 73690657 Rat 1582227 Gluco30 Glucose level QTL 30 3.6 0.0003 blood glucose amount (VT:0000188) absolute change in blood glucose level area under curve (CMO:0002034) 15 28030665 82262678 Rat 1582228 Epfw3 Epididymal fat weight QTL 3 4.1 0.0002 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 15 28030665 82262678 Rat 1578646 Bmd18 Bone mineral density QTL 18 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 15 22806240 98288169 Rat 1578647 Bmd17 Bone mineral density QTL 17 4 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 15 22806240 98288169 Rat 2293686 Bmd36 Bone mineral density QTL 36 7.4 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 15 33611058 71477291 Rat 2317750 Glom26 Glomerulus QTL 26 4.3 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 15 12496141 65205939 Rat 2298549 Neuinf12 Neuroinflammation QTL 12 3.5 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 15 1 55302115 Rat 2293691 Bmd37 Bone mineral density QTL 37 6.6 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 15 33611058 71477291 Rat 2293688 Bss29 Bone structure and strength QTL 29 5.31 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 15 11111142 56111142 Rat 1582214 Stl21 Serum triglyceride level QTL 21 3.1 0.022 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 15 28030665 82262678 Rat 631273 Lecl2 Lens clarity QTL 2 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 15 10596089 55596089 Rat 1300144 Rf23 Renal function QTL 23 3.61 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 15 40631268 98288169 Rat 2300167 Bmd63 Bone mineral density QTL 63 5.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 738017 Hcas7 Hepatocarcinoma susceptibility QTL 7 2.91 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 15 2266368 46921453 Rat 152025253 Hrtrt24 Heart rate QTL 24 3.82 heart pumping trait (VT:2000009) 15 27885774 86257085 Rat 10054130 Srcrt8 Stress Responsive Cort QTL 8 2.18 0.0085 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 15 22117933 67117933 Rat 2300173 Bmd62 Bone mineral density QTL 62 12.8 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 2324620 Coatc3 Coat color QTL 3 coat/hair pigmentation trait (VT:0010463) pigmented coat/hair area to total coat/hair area ratio (CMO:0001810) 15 19856566 46187442 Rat 61424 Scl1 Serum cholesterol level QTL 1 7.7 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 15 16725528 80672115 Rat 1582251 Gluco24 Glucose level QTL 24 3.2 0.0008 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 15 5530756 50530756 Rat 1598828 Glom14 Glomerulus QTL 14 2.5 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 15 34054139 79054139 Rat 1582242 Gluco28 Glucose level QTL 28 3.3 0.0008 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 15 28030665 82262678 Rat 2306968 Anxrr23 Anxiety related response QTL 23 4.83 reflex trait (VT:0001961) amplitude of the acoustic startle response (CMO:0001520) 15 40631268 46187442 Rat 1578660 Bss19 Bone structure and strength QTL 19 4.3 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 15 22806240 98288169 Rat 1582244 Bw79 Body weight QTL 79 4 0.0002 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 15 28030665 82262678 Rat 7411725 Strs7 Sensitivity to stroke QTL 7 3.8 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 15 40289901 49308583 Rat
BI278614
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 45,551,817 - 45,551,986 (+) MAPPER mRatBN7.2 Rnor_6.0 15 52,166,616 - 52,166,784 NCBI Rnor6.0 Rnor_5.0 15 55,890,133 - 55,890,301 UniSTS Rnor5.0 RGSC_v3.4 15 50,878,359 - 50,878,527 UniSTS RGSC3.4 Celera 15 45,230,826 - 45,230,994 UniSTS Cytogenetic Map 15 p11 UniSTS
RH94751
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 15 52,006,489 - 52,006,615 (+) Marker Load Pipeline mRatBN7.2 15 45,596,780 - 45,596,906 (+) MAPPER mRatBN7.2 Rnor_6.0 15 52,211,751 - 52,211,876 NCBI Rnor6.0 Rnor_5.0 15 55,935,268 - 55,935,393 UniSTS Rnor5.0 RGSC_v3.4 15 50,923,318 - 50,923,443 UniSTS RGSC3.4 Celera 15 45,275,184 - 45,275,309 UniSTS Cytogenetic Map 15 p11 UniSTS
RH143871
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 45,556,132 - 45,556,291 (+) MAPPER mRatBN7.2 Rnor_6.0 15 52,170,931 - 52,171,089 NCBI Rnor6.0 Rnor_5.0 15 55,894,448 - 55,894,606 UniSTS Rnor5.0 RGSC_v3.4 15 50,882,674 - 50,882,832 UniSTS RGSC3.4 Celera 15 45,235,136 - 45,235,294 UniSTS Cytogenetic Map 15 p11 UniSTS
RH136856
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 45,596,682 - 45,596,873 (+) MAPPER mRatBN7.2 Rnor_6.0 15 52,211,653 - 52,211,843 NCBI Rnor6.0 Rnor_5.0 15 55,935,170 - 55,935,360 UniSTS Rnor5.0 RGSC_v3.4 15 50,923,220 - 50,923,410 UniSTS RGSC3.4 Celera 15 45,275,086 - 45,275,276 UniSTS Cytogenetic Map 15 p11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000046054 ⟹ ENSRNOP00000040287
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 45,551,603 - 45,595,776 (-) Ensembl Rnor_6.0 Ensembl 15 52,166,401 - 52,210,746 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000099340 ⟹ ENSRNOP00000083692
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 45,583,813 - 45,595,776 (-) Ensembl
RefSeq Acc Id:
NM_031323 ⟹ NP_112613
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 51,961,310 - 52,005,485 (-) NCBI mRatBN7.2 15 45,551,603 - 45,595,776 (-) NCBI Rnor_6.0 15 52,166,401 - 52,210,746 (-) NCBI Rnor_5.0 15 55,889,918 - 55,934,263 (-) NCBI RGSC_v3.4 15 50,878,144 - 50,922,313 (-) RGD Celera 15 45,230,611 - 45,274,179 (-) RGD
Sequence:
GGAAACGGGACGGGAAGAGGTGGCCTCGGGGGGAGAGCGCCTCCCCTTCGCCTTCAGCGCTCCCTTCCCGGTCGCCCCGCTCCCGCGTCCGGGCGCGACCGCCACCGCTGCCCGCCAGCATGCCCGGC
hide sequence
RefSeq Acc Id:
XM_006252285 ⟹ XP_006252347
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 51,961,312 - 51,994,213 (-) NCBI mRatBN7.2 15 45,551,605 - 45,584,510 (-) NCBI Rnor_6.0 15 52,166,403 - 52,199,169 (-) NCBI Rnor_5.0 15 55,889,918 - 55,934,263 (-) NCBI
Sequence:
GCAGCCAGAGGGCAGTCTTCCGGCAGGCCATGAGACACTGGGAGAAGCATACCTGTGTCACCTT
hide sequence
RefSeq Acc Id:
XM_039093689 ⟹ XP_038949617
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 51,964,467 - 52,005,596 (-) NCBI mRatBN7.2 15 45,554,765 - 45,595,861 (-) NCBI
RefSeq Acc Id:
XM_039093690 ⟹ XP_038949618
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 51,961,312 - 51,994,213 (-) NCBI mRatBN7.2 15 45,551,605 - 45,584,510 (-) NCBI
RefSeq Acc Id:
XM_063274694 ⟹ XP_063130764
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 51,972,855 - 52,005,597 (-) NCBI
RefSeq Acc Id:
XM_063274695 ⟹ XP_063130765
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 51,974,490 - 52,005,596 (-) NCBI
RefSeq Acc Id:
NP_112613 ⟸ NM_031323
- Peptide Label:
precursor
- UniProtKB:
F1M798 (UniProtKB/TrEMBL), A6HTK6 (UniProtKB/TrEMBL)
- Sequence:
MPGVARPPLPLLSLPLLLLLLLPRAGRPLDLADYTYDLGEEDAPELLNYKDPCKAAAFLGDIALDEEDLRAFRVQQAAVLRQQTAQRSSIKAAGNSSALGRQSTSGQPQRGSRGRWRSRPRSRRAATS
hide sequence
RefSeq Acc Id:
XP_006252347 ⟸ XM_006252285
- Peptide Label:
isoform X2
- UniProtKB:
A6HTK7 (UniProtKB/TrEMBL)
- Sequence:
MRTAILYSPTDPAARDHPPELAPPSRCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEVQEVESLGETYDFDSIMHYARNTFSRGIFLDTI
hide sequence
Ensembl Acc Id:
ENSRNOP00000040287 ⟸ ENSRNOT00000046054
RefSeq Acc Id:
XP_038949618 ⟸ XM_039093690
- Peptide Label:
isoform X3
- UniProtKB:
A6HTK7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038949617 ⟸ XM_039093689
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSRNOP00000083692 ⟸ ENSRNOT00000099340
RefSeq Acc Id:
XP_063130764 ⟸ XM_063274694
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_063130765 ⟸ XM_063274695
- Peptide Label:
isoform X5
RGD ID: 13699810 Promoter ID: EPDNEW_R10333 Type: initiation region Name: Bmp1_1 Description: bone morphogenetic protein 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 15 52,210,683 - 52,210,743 EPDNEW
BioCyc Gene G2FUF-13214 BioCyc
Ensembl Genes ENSRNOG00000010890 Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000046054 ENTREZGENE
ENSRNOT00000046054.5 UniProtKB/TrEMBL
ENSRNOT00000099340.1 UniProtKB/TrEMBL
Gene3D-CATH 2.60.120.290 UniProtKB/TrEMBL
3.40.390.10 UniProtKB/TrEMBL
Laminin UniProtKB/TrEMBL
InterPro BMP_1/tolloid-like UniProtKB/TrEMBL
CUB_dom UniProtKB/TrEMBL
EG-like_dom UniProtKB/TrEMBL
EGF-like_Ca-bd UniProtKB/TrEMBL
EGF-type_Asp/Asn_hydroxyl_site UniProtKB/TrEMBL
EGF_Ca-bd_CS UniProtKB/TrEMBL
MetalloPept_cat_dom UniProtKB/TrEMBL
NOTCH1_EGF-like UniProtKB/TrEMBL
Peptidase_M12A UniProtKB/TrEMBL
Peptidase_Metallo UniProtKB/TrEMBL
sperma_CUB_dom UniProtKB/TrEMBL
ZnMP_TLD/BMP1 UniProtKB/TrEMBL
KEGG Report rno:83470 UniProtKB/TrEMBL
NCBI Gene 83470 ENTREZGENE
PANTHER BONE MORPHOGENETIC PROTEIN 1 UniProtKB/TrEMBL
BONE MORPHOGENETIC PROTEIN 1 UniProtKB/TrEMBL
DISCOIDIN, CUB, EGF, LAMININ , AND ZINC METALLOPROTEASE DOMAIN CONTAINING UniProtKB/TrEMBL
OVOCHYMASE-RELATED UniProtKB/TrEMBL
Pfam Astacin UniProtKB/TrEMBL
CUB UniProtKB/TrEMBL
EGF_CA UniProtKB/TrEMBL
FXa_inhibition UniProtKB/TrEMBL
PharmGKB BMP1 RGD
PhenoGen Bmp1 PhenoGen
PIRSF BMP_1/tolloid-like UniProtKB/TrEMBL
PRINTS ASTACIN UniProtKB/TrEMBL
PROSITE ASTACIN UniProtKB/TrEMBL
ASX_HYDROXYL UniProtKB/TrEMBL
CUB UniProtKB/TrEMBL
EGF_2 UniProtKB/TrEMBL
EGF_3 UniProtKB/TrEMBL
EGF_CA UniProtKB/TrEMBL
RatGTEx ENSRNOG00000010890 RatGTEx
SMART CUB UniProtKB/TrEMBL
EGF UniProtKB/TrEMBL
EGF_CA UniProtKB/TrEMBL
ZnMc UniProtKB/TrEMBL
Superfamily-SCOP CUB UniProtKB/TrEMBL
EGF/Laminin UniProtKB/TrEMBL
Metalloproteases ('zincins'), catalytic domain UniProtKB/TrEMBL
UniProt A0A8I6A0H3_RAT UniProtKB/TrEMBL
A6HTK6 ENTREZGENE, UniProtKB/TrEMBL
A6HTK7 ENTREZGENE, UniProtKB/TrEMBL
A6HTK8_RAT UniProtKB/TrEMBL
F1M798 ENTREZGENE, UniProtKB/TrEMBL
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-11-17
Bmp1
bone morphogenetic protein 1
bone morphogenetic protein 1 (procollagen C-proetinase)
Name updated
1299863 APPROVED
2002-08-07
Bmp1
bone morphogenetic protein 1 (procollagen C-proetinase)
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_product
member of the TGF-beta superfamily
634636
