Symbol:
Pygl
Name:
glycogen phosphorylase L
RGD ID:
620687
Description:
Enables carbohydrate binding activity; glycogen phosphorylase activity; and identical protein binding activity. Involved in 5-phosphoribose 1-diphosphate biosynthetic process and glycogen catabolic process. Predicted to be located in cytosol. Predicted to be active in cytoplasm. Used to study glycogen storage disease VI and lactic acidosis. Human ortholog(s) of this gene implicated in glycogen storage disease; glycogen storage disease VI; and lactic acidosis. Orthologous to human PYGL (glycogen phosphorylase L); PARTICIPATES IN glycogen degradation pathway; glycogen metabolic pathway; congenital sucrase-isomaltase deficiency pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
glycogen phosphorylase; glycogen phosphorylase, liver form; liver glycogen phosphorylase; phosphorylase, glycogen, liver
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PYGL (glycogen phosphorylase L) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Pygl (liver glycogen phosphorylase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pygl (glycogen phosphorylase L) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PYGL (glycogen phosphorylase L) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PYGL (glycogen phosphorylase L) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pygl (glycogen phosphorylase L) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PYGL (glycogen phosphorylase L) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PYGL (glycogen phosphorylase L) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pygl (glycogen phosphorylase L) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
UTRN (utrophin) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
PYGL (glycogen phosphorylase L)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Pygl (liver glycogen phosphorylase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
pygl (phosphorylase, glycogen, liver)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
GPH1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
GlyP
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
pygl-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
pygl
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 94,433,558 - 94,476,219 (-) NCBI GRCr8 mRatBN7.2 6 88,697,598 - 88,740,260 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 88,697,593 - 88,740,310 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 89,096,834 - 89,133,820 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 89,396,285 - 89,433,272 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 88,835,817 - 88,872,806 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 92,597,759 - 92,643,734 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 92,597,706 - 92,643,847 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 102,045,144 - 102,091,119 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 92,298,339 - 92,341,347 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 92,301,796 - 92,344,803 (-) NCBI Celera 6 87,191,869 - 87,228,313 (-) NCBI Celera Cytogenetic Map 6 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pygl Rat (1->4)-beta-D-glucan multiple interactions ISO Pygl (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of PYGL mRNA CTD PMID:36331819 Pygl Rat 1,1-dichloroethene decreases expression ISO Pygl (Mus musculus) 6480464 vinylidene chloride results in decreased expression of PYGL mRNA CTD PMID:26682919 Pygl Rat 1,2-dichloroethane decreases expression ISO Pygl (Mus musculus) 6480464 ethylene dichloride results in decreased expression of PYGL mRNA and ethylene dichloride results in decreased expression of PYGL protein CTD PMID:28189721 and PMID:28960355 Pygl Rat 1,2-dimethylhydrazine decreases expression ISO Pygl (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of PYGL mRNA CTD PMID:22206623 Pygl Rat 1-chloro-2,4-dinitrobenzene affects binding ISO PYGL (Homo sapiens) 6480464 Dinitrochlorobenzene binds to PYGL protein CTD PMID:32991956 Pygl Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of PYGL mRNA CTD PMID:17522070 Pygl Rat 17alpha-ethynylestradiol multiple interactions ISO Pygl (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PYGL mRNA CTD PMID:17942748 Pygl Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of PYGL mRNA CTD PMID:17557909 Pygl Rat 17beta-estradiol decreases expression ISO Pygl (Mus musculus) 6480464 Estradiol results in decreased expression of PYGL mRNA CTD PMID:19484750 and PMID:39298647 Pygl Rat 17beta-estradiol multiple interactions ISO PYGL (Homo sapiens) 6480464 [Estradiol co-treated with Norethindrone Acetate] results in increased expression of PYGL mRNA CTD PMID:22217510 Pygl Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of PYGL mRNA CTD PMID:26496021 Pygl Rat 1H-pyrazole decreases expression ISO Pygl (Mus musculus) 6480464 pyrazole results in decreased expression of PYGL mRNA CTD PMID:17945193 Pygl Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Pygl (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Pygl Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Pygl (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PYGL mRNA CTD PMID:17942748 Pygl Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Pygl (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PYGL mRNA CTD PMID:19770486 and PMID:27562557 Pygl Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO PYGL (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of PYGL mRNA CTD PMID:22903824 Pygl Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PYGL mRNA CTD PMID:20959002 and PMID:21215274 Pygl Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Pygl (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PYGL mRNA CTD PMID:21570461 Pygl Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Pygl (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Pygl Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of PYGL mRNA CTD PMID:21346803 Pygl Rat 2,6-dimethoxyphenol multiple interactions ISO PYGL (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Pygl Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of PYGL mRNA CTD PMID:21346803 Pygl Rat 2-hydroxypropanoic acid decreases expression ISO PYGL (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PYGL mRNA CTD PMID:30851411 Pygl Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:27509375 more ... Pygl Rat 3,3',4,4',5-pentachlorobiphenyl multiple interactions EXP 6480464 AHR protein affects the reaction [3 more ... CTD PMID:34848246 Pygl Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of PYGL protein CTD PMID:26597043 Pygl Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of PYGL mRNA CTD PMID:19162173 Pygl Rat 4'-hydroxyacetophenone affects binding EXP 6480464 4-hydroxyacetophenone binds to PYGL protein CTD PMID:15236443 Pygl Rat 4,4'-diaminodiphenylmethane increases expression ISO Pygl (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of PYGL mRNA CTD PMID:18648102 Pygl Rat 4,4'-sulfonyldiphenol increases expression ISO Pygl (Mus musculus) 6480464 bisphenol S results in increased expression of PYGL mRNA CTD PMID:30951980 and PMID:39298647 Pygl Rat 4,4'-sulfonyldiphenol increases expression ISO PYGL (Homo sapiens) 6480464 bisphenol S results in increased expression of PYGL protein CTD PMID:34186270 Pygl Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of PYGL mRNA CTD PMID:19483382 Pygl Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of PYGL mRNA CTD PMID:19483382 Pygl Rat 8-Br-cAMP decreases expression ISO PYGL (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in decreased expression of PYGL mRNA CTD PMID:22079614 Pygl Rat acetylsalicylic acid affects binding EXP 6480464 Aspirin binds to PYGL protein CTD PMID:15236443 Pygl Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of PYGL mRNA CTD PMID:31644924 Pygl Rat acrylamides affects binding ISO PYGL (Homo sapiens) 6480464 Acrylamides analog binds to PYGL protein CTD PMID:18723356 Pygl Rat acrylamides decreases activity ISO PYGL (Homo sapiens) 6480464 Acrylamides analog results in decreased activity of PYGL protein CTD PMID:18723356 Pygl Rat actinomycin D multiple interactions ISO PYGL (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of and results in increased secretion of PYGL protein CTD PMID:38460933 Pygl Rat aldehydo-D-glucose multiple interactions EXP 6480464 Glucose inhibits the reaction [[Phenylephrine co-treated with Calcium] results in increased activity of PYGL protein] CTD PMID:747652 Pygl Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of PYGL mRNA CTD PMID:35163327 Pygl Rat aluminium phosphide increases activity EXP 6480464 aluminum phosphide results in increased activity of PYGL protein CTD PMID:20929055 Pygl Rat alvocidib affects binding ISO PYGL (Homo sapiens) 6480464 PYGL protein binds to alvocidib CTD PMID:11368340 Pygl Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of PYGL mRNA CTD PMID:19483382 Pygl Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PYGL mRNA CTD PMID:16483693 Pygl Rat arsenite(3-) multiple interactions ISO Pygl (Mus musculus) 6480464 arsenite inhibits the reaction [INS protein results in decreased activity of PYGL protein] CTD PMID:28952001 Pygl Rat arsenous acid increases expression ISO PYGL (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PYGL mRNA CTD PMID:20458559 Pygl Rat atrazine increases expression ISO PYGL (Homo sapiens) 6480464 Atrazine results in increased expression of PYGL mRNA CTD PMID:22378314 Pygl Rat baicalein decreases activity ISO PYGL (Homo sapiens) 6480464 baicalein results in decreased activity of PYGL protein CTD PMID:37277066 Pygl Rat benzamide decreases activity ISO PYGL (Homo sapiens) 6480464 benzamide analog results in decreased activity of PYGL protein CTD PMID:19758809 Pygl Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of PYGL mRNA CTD PMID:19483382 Pygl Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of PYGL mRNA CTD PMID:21839799 Pygl Rat benzo[a]pyrene affects methylation ISO PYGL (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PYGL promoter CTD PMID:27901495 Pygl Rat benzo[a]pyrene decreases expression ISO Pygl (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of PYGL mRNA CTD PMID:22228805 Pygl Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of PYGL promoter CTD PMID:23359474 Pygl Rat bis(2-ethylhexyl) phthalate increases expression ISO Pygl (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of PYGL mRNA CTD PMID:35716406 Pygl Rat bis(2-ethylhexyl) phthalate increases expression ISO PYGL (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of PYGL mRNA CTD PMID:31163220 Pygl Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of PYGL promoter and [bisphenol A co-treated with Estradiol] results in increased expression of PYGL mRNA CTD PMID:23359474 and PMID:26496021 Pygl Rat bisphenol A increases expression ISO PYGL (Homo sapiens) 6480464 bisphenol A results in increased expression of PYGL protein CTD PMID:37567409 Pygl Rat bisphenol A decreases expression ISO PYGL (Homo sapiens) 6480464 bisphenol A results in decreased expression of PYGL protein CTD PMID:34186270 Pygl Rat bisphenol A decreases expression ISO Pygl (Mus musculus) 6480464 bisphenol A results in decreased expression of PYGL protein CTD PMID:35999755 Pygl Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PYGL mRNA CTD PMID:30816183 and PMID:32528016 Pygl Rat bisphenol A increases expression ISO Pygl (Mus musculus) 6480464 bisphenol A results in increased expression of PYGL mRNA CTD PMID:30951980 and PMID:38701888 Pygl Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PYGL mRNA CTD PMID:25181051 Pygl Rat bisphenol AF increases expression ISO PYGL (Homo sapiens) 6480464 bisphenol AF results in increased expression of PYGL protein CTD PMID:34186270 Pygl Rat Bisphenol B increases expression ISO PYGL (Homo sapiens) 6480464 bisphenol B results in increased expression of PYGL protein CTD PMID:34186270 Pygl Rat bisphenol F increases expression ISO Pygl (Mus musculus) 6480464 bisphenol F results in increased expression of PYGL mRNA CTD PMID:30951980 Pygl Rat bisphenol F increases expression ISO PYGL (Homo sapiens) 6480464 bisphenol F results in increased expression of PYGL protein CTD PMID:34186270 Pygl Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of PYGL mRNA CTD PMID:24136188 Pygl Rat cadmium dichloride increases expression ISO PYGL (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of PYGL mRNA CTD PMID:26472689 Pygl Rat Calcimycin increases activity EXP 6480464 Calcimycin results in increased activity of PYGL protein CTD PMID:6430282 Pygl Rat Calcimycin multiple interactions EXP 6480464 Calcium deficiency inhibits the reaction [Calcimycin results in increased activity of PYGL protein] CTD PMID:6430282 Pygl Rat calcium atom multiple interactions EXP 6480464 [Phenylephrine co-treated with Calcium] results in increased activity of PYGL protein more ... CTD PMID:6430282 and PMID:747652 Pygl Rat calcium(0) multiple interactions EXP 6480464 [Phenylephrine co-treated with Calcium] results in increased activity of PYGL protein more ... CTD PMID:6430282 and PMID:747652 Pygl Rat carbon nanotube decreases expression ISO Pygl (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Pygl Rat chlordecone increases expression ISO Pygl (Mus musculus) 6480464 Chlordecone results in increased expression of PYGL mRNA CTD PMID:33711761 Pygl Rat chloroacetaldehyde affects expression ISO PYGL (Homo sapiens) 6480464 chloroacetaldehyde affects the expression of PYGL mRNA CTD PMID:25596134 Pygl Rat chloroacetic acid decreases expression ISO Pygl (Mus musculus) 6480464 chloroacetic acid results in decreased expression of PYGL mRNA and chloroacetic acid results in decreased expression of PYGL protein CTD PMID:28189721 Pygl Rat chloroform decreases expression EXP 6480464 Chloroform results in decreased expression of PYGL mRNA CTD PMID:17522070 Pygl Rat chloropicrin decreases expression ISO PYGL (Homo sapiens) 6480464 chloropicrin results in decreased expression of PYGL mRNA CTD PMID:28476498 Pygl Rat chloropicrin increases expression ISO PYGL (Homo sapiens) 6480464 chloropicrin results in increased expression of PYGL mRNA CTD PMID:26352163 Pygl Rat ciguatoxin CTX1B affects expression ISO Pygl (Mus musculus) 6480464 Ciguatoxins affects the expression of PYGL mRNA CTD PMID:18353800 Pygl Rat cisplatin decreases expression ISO PYGL (Homo sapiens) 6480464 Cisplatin results in decreased expression of PYGL mRNA CTD PMID:25596134 Pygl Rat cisplatin increases expression ISO PYGL (Homo sapiens) 6480464 Cisplatin results in increased expression of PYGL mRNA CTD PMID:27392435 more ... Pygl Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of PYGL mRNA CTD PMID:19483382 Pygl Rat clofibrate decreases expression EXP 6480464 Clofibrate results in decreased expression of PYGL protein CTD PMID:16470657 Pygl Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of PYGL mRNA CTD PMID:24386269 Pygl Rat copper(II) sulfate decreases expression ISO PYGL (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of PYGL mRNA CTD PMID:19549813 Pygl Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of PYGL mRNA CTD PMID:26577399 Pygl Rat cyclosporin A decreases expression ISO Pygl (Mus musculus) 6480464 Cyclosporine results in decreased expression of PYGL mRNA CTD PMID:19770486 Pygl Rat cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of PYGL mRNA CTD PMID:25596134 Pygl Rat cyclosporin A decreases expression ISO PYGL (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PYGL mRNA CTD PMID:25562108 and PMID:25596134 Pygl Rat D-glucose multiple interactions EXP 6480464 Glucose inhibits the reaction [[Phenylephrine co-treated with Calcium] results in increased activity of PYGL protein] CTD PMID:747652 Pygl Rat DDE increases expression ISO PYGL (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of PYGL mRNA CTD PMID:38568856 Pygl Rat dexamethasone increases expression ISO PYGL (Homo sapiens) 6480464 Dexamethasone results in increased expression of PYGL mRNA CTD PMID:25047013 Pygl Rat dextran sulfate decreases expression ISO Pygl (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of PYGL protein CTD PMID:35999755 Pygl Rat diarsenic trioxide increases expression ISO PYGL (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PYGL mRNA CTD PMID:20458559 Pygl Rat Dibutyl phosphate affects expression ISO PYGL (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PYGL mRNA CTD PMID:37042841 Pygl Rat dibutyl phthalate multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of PYGL promoter CTD PMID:23359474 Pygl Rat dichlorvos increases activity EXP 6480464 Dichlorvos results in increased activity of PYGL protein CTD PMID:222008 Pygl Rat Diosbulbin B increases expression ISO Pygl (Mus musculus) 6480464 diosbulbin B results in increased expression of PYGL mRNA CTD PMID:32148032 Pygl Rat dioxygen increases expression ISO Pygl (Mus musculus) 6480464 Oxygen deficiency results in increased expression of PYGL mRNA CTD PMID:20880076 Pygl Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of PYGL mRNA CTD PMID:33729688 Pygl Rat dioxygen increases expression ISO PYGL (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of PYGL mRNA CTD PMID:25596134 Pygl Rat dorsomorphin multiple interactions ISO PYGL (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Pygl Rat doxorubicin increases expression ISO PYGL (Homo sapiens) 6480464 Doxorubicin results in increased expression of PYGL mRNA CTD PMID:30031762 Pygl Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of PYGL mRNA CTD PMID:29391264 Pygl Rat entinostat increases expression ISO PYGL (Homo sapiens) 6480464 entinostat results in increased expression of PYGL mRNA CTD PMID:27188386 Pygl Rat erythromycin estolate decreases expression EXP 6480464 Erythromycin Estolate results in decreased expression of PYGL mRNA CTD PMID:17522070 Pygl Rat fenofibrate increases expression EXP 6480464 Fenofibrate results in increased expression of PYGL mRNA CTD PMID:25596134 Pygl Rat furfural multiple interactions ISO PYGL (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Pygl Rat Geniposide increases expression EXP 21079733 Geniposide increased expression of PYGL in serum RGD Pygl Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of PYGL mRNA CTD PMID:24136188 Pygl Rat glucose multiple interactions EXP 6480464 Glucose inhibits the reaction [[Phenylephrine co-treated with Calcium] results in increased activity of PYGL protein] CTD PMID:747652 Pygl Rat glyphosate increases expression ISO Pygl (Mus musculus) 6480464 Glyphosate results in increased expression of PYGL protein CTD PMID:37208198 Pygl Rat glyphosate decreases expression ISO Pygl (Mus musculus) 6480464 Glyphosate results in decreased expression of PYGL protein CTD PMID:36173347 Pygl Rat ibuprofen increases expression EXP 6480464 Ibuprofen results in increased expression of PYGL mRNA CTD PMID:25596134 Pygl Rat ifosfamide decreases expression ISO PYGL (Homo sapiens) 6480464 Ifosfamide results in decreased expression of PYGL mRNA CTD PMID:25596134 Pygl Rat isoprenaline increases activity EXP 6480464 Isoproterenol results in increased activity of PYGL protein CTD PMID:6430282 Pygl Rat ivermectin decreases expression ISO PYGL (Homo sapiens) 6480464 Ivermectin results in decreased expression of PYGL protein CTD PMID:32959892 Pygl Rat ketoconazole increases expression EXP 6480464 Ketoconazole results in increased expression of PYGL mRNA CTD PMID:37077353 Pygl Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of PYGL mRNA CTD PMID:19483382 Pygl Rat malathion multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Malathion results in increased expression of PYGL mRNA] CTD PMID:25449180 Pygl Rat malathion increases expression EXP 6480464 Malathion results in increased expression of PYGL mRNA CTD PMID:25449180 Pygl Rat metformin decreases expression EXP 6480464 Metformin results in decreased expression of PYGL mRNA CTD PMID:25596134 Pygl Rat methylarsonite multiple interactions ISO Pygl (Mus musculus) 6480464 methylarsonite inhibits the reaction [INS protein results in decreased activity of PYGL protein] CTD PMID:28952001 Pygl Rat methylmercury chloride decreases expression ISO PYGL (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of PYGL mRNA CTD PMID:23179753 and PMID:27188386 Pygl Rat Muraglitazar increases expression EXP 6480464 muraglitazar results in increased expression of PYGL mRNA CTD PMID:21515302 Pygl Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Malathion results in increased expression of PYGL mRNA] CTD PMID:25449180 Pygl Rat N-nitrosomorpholine decreases expression EXP 6480464 N-nitrosomorpholine results in decreased expression of PYGL protein CTD PMID:2885971 Pygl Rat N-nitrosomorpholine affects expression EXP 6480464 N-nitrosomorpholine affects the expression of PYGL protein CTD PMID:19716841 Pygl Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of PYGL mRNA CTD PMID:24136188 Pygl Rat neostigmine increases activity EXP 6480464 Neostigmine results in increased activity of PYGL protein modified form CTD PMID:1350317 Pygl Rat neostigmine multiple interactions EXP 6480464 Phentolamine inhibits the reaction [Neostigmine results in increased activity of PYGL protein modified form] CTD PMID:1350317 Pygl Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of PYGL mRNA CTD PMID:22110744 Pygl Rat nicotinamide multiple interactions EXP 6480464 [Streptozocin co-treated with Niacinamide] affects the activity of PYGL protein and resveratrol inhibits the reaction [[Streptozocin co-treated with Niacinamide] affects the activity of PYGL protein] CTD PMID:19059388 Pygl Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of PYGL mRNA CTD PMID:24136188 Pygl Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of PYGL mRNA CTD PMID:33484710 Pygl Rat Nutlin-3 multiple interactions ISO PYGL (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of and results in increased secretion of PYGL protein CTD PMID:38460933 Pygl Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of PYGL mRNA CTD PMID:19483382 Pygl Rat orotic acid decreases expression EXP 6480464 Orotic Acid results in decreased expression of PYGL mRNA CTD PMID:17203948 Pygl Rat ozone multiple interactions ISO Pygl (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of PYGL mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of PYGL mRNA CTD PMID:34911549 Pygl Rat paracetamol affects expression ISO Pygl (Mus musculus) 6480464 Acetaminophen affects the expression of PYGL mRNA CTD PMID:17562736 Pygl Rat paracetamol multiple interactions ISO Pygl (Mus musculus) 6480464 PANX1 gene mutant form inhibits the reaction [Acetaminophen results in decreased expression of PYGL mRNA] CTD PMID:29246445 Pygl Rat paracetamol decreases expression ISO Pygl (Mus musculus) 6480464 Acetaminophen results in decreased expression of PYGL mRNA CTD PMID:29246445 Pygl Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of PYGL mRNA CTD PMID:17522070 Pygl Rat paracetamol multiple interactions ISO PYGL (Homo sapiens) 6480464 [Dietary Carbohydrates co-treated with Acetaminophen] results in increased expression of PYGL mRNA CTD PMID:17093179 Pygl Rat perfluorooctane-1-sulfonic acid decreases expression EXP 6480464 perfluorooctane sulfonic acid results in decreased expression of PYGL mRNA CTD PMID:19162173 Pygl Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Pygl (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of PYGL mRNA CTD PMID:36331819 Pygl Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of PYGL mRNA and perfluorooctanoic acid results in decreased expression of PYGL protein CTD PMID:19162173 and PMID:34958885 Pygl Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of PYGL mRNA CTD PMID:35163327 Pygl Rat phentolamine multiple interactions EXP 6480464 Phentolamine inhibits the reaction [Neostigmine results in increased activity of PYGL protein modified form] CTD PMID:1350317 Pygl Rat phenylephrine multiple interactions EXP 6480464 [Phenylephrine co-treated with Calcium] results in increased activity of PYGL protein and Glucose inhibits the reaction [[Phenylephrine co-treated with Calcium] results in increased activity of PYGL protein] CTD PMID:747652 Pygl Rat phenylephrine increases expression EXP 6480464 Phenylephrine results in increased expression of PYGL mRNA CTD PMID:18158353 Pygl Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of PYGL mRNA CTD PMID:19483382 Pygl Rat potassium chromate increases expression ISO PYGL (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of PYGL mRNA CTD PMID:22714537 Pygl Rat procyanidin B1 multiple interactions ISO PYGL (Homo sapiens) 6480464 [procyanidin B1 co-treated with p-coumaric acid] results in decreased activity of PYGL protein CTD PMID:34342938 Pygl Rat procyanidin B1 multiple interactions ISO Pygl (Mus musculus) 6480464 [procyanidin B1 co-treated with p-coumaric acid] results in decreased activity of PYGL protein CTD PMID:34342938 Pygl Rat procyanidin B1 decreases activity ISO Pygl (Mus musculus) 6480464 procyanidin B1 results in decreased activity of PYGL protein CTD PMID:34342938 Pygl Rat procyanidin B1 decreases activity ISO PYGL (Homo sapiens) 6480464 procyanidin B1 results in decreased activity of PYGL protein CTD PMID:34342938 Pygl Rat pyrogallol increases expression ISO Pygl (Mus musculus) 6480464 Pyrogallol results in increased expression of PYGL mRNA CTD PMID:20362636 Pygl Rat rac-lactic acid decreases expression ISO PYGL (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PYGL mRNA CTD PMID:30851411 Pygl Rat resveratrol multiple interactions EXP 6480464 resveratrol inhibits the reaction [[Streptozocin co-treated with Niacinamide] affects the activity of PYGL protein] CTD PMID:19059388 Pygl Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of PYGL mRNA CTD PMID:28374803 Pygl Rat rotenone increases expression ISO PYGL (Homo sapiens) 6480464 Rotenone results in increased expression of PYGL mRNA CTD PMID:29955902 Pygl Rat SB 431542 multiple interactions ISO PYGL (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Pygl Rat sodium arsenite decreases expression ISO PYGL (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PYGL mRNA CTD PMID:38568856 Pygl Rat sodium chloride multiple interactions ISO PYGL (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of PYGL protein more ... CTD PMID:38598786 Pygl Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of PYGL mRNA CTD PMID:25993096 Pygl Rat streptozocin multiple interactions EXP 6480464 [Streptozocin co-treated with Niacinamide] affects the activity of PYGL protein and resveratrol inhibits the reaction [[Streptozocin co-treated with Niacinamide] affects the activity of PYGL protein] CTD PMID:19059388 Pygl Rat streptozocin decreases expression EXP 6480464 Streptozocin results in decreased expression of PYGL mRNA CTD PMID:25905778 Pygl Rat sunitinib decreases expression ISO PYGL (Homo sapiens) 6480464 Sunitinib results in decreased expression of PYGL mRNA CTD PMID:31533062 Pygl Rat temozolomide increases expression ISO PYGL (Homo sapiens) 6480464 Temozolomide results in increased expression of PYGL mRNA CTD PMID:31758290 Pygl Rat tert-butyl hydroperoxide increases expression ISO PYGL (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of PYGL mRNA CTD PMID:15336504 Pygl Rat Tesaglitazar increases expression EXP 6480464 tesaglitazar results in increased expression of PYGL mRNA CTD PMID:21515302 Pygl Rat testosterone decreases expression ISO PYGL (Homo sapiens) 6480464 Testosterone results in decreased expression of PYGL mRNA CTD PMID:33359661 Pygl Rat tetrachloromethane affects expression ISO Pygl (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of PYGL mRNA CTD PMID:17484886 Pygl Rat tetrachloromethane decreases expression ISO Pygl (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of PYGL mRNA CTD PMID:27339419 and PMID:31919559 Pygl Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of PYGL mRNA CTD PMID:17522070 and PMID:31150632 Pygl Rat tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of PYGL mRNA CTD PMID:15963342 Pygl Rat tetracycline decreases expression EXP 6480464 Tetracycline results in decreased expression of PYGL mRNA CTD PMID:17522070 Pygl Rat thimerosal decreases expression ISO PYGL (Homo sapiens) 6480464 Thimerosal results in decreased expression of PYGL mRNA CTD PMID:27188386 Pygl Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of PYGL mRNA CTD PMID:19483382 Pygl Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of PYGL mRNA CTD PMID:34492290 Pygl Rat thiram decreases expression ISO PYGL (Homo sapiens) 6480464 Thiram results in decreased expression of PYGL mRNA CTD PMID:38568856 Pygl Rat titanium dioxide decreases expression ISO Pygl (Mus musculus) 6480464 titanium dioxide results in decreased expression of PYGL mRNA CTD PMID:23557971 Pygl Rat titanium dioxide decreases methylation ISO Pygl (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PYGL gene CTD PMID:35295148 Pygl Rat titanium dioxide affects expression ISO Pygl (Mus musculus) 6480464 titanium dioxide affects the expression of PYGL mRNA CTD PMID:17656681 Pygl Rat trichostatin A increases expression ISO PYGL (Homo sapiens) 6480464 trichostatin A results in increased expression of PYGL mRNA CTD PMID:24935251 and PMID:26272509 Pygl Rat trichostatin A multiple interactions ISO PYGL (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PYGL mRNA CTD PMID:27188386 Pygl Rat triphenyl phosphate affects expression ISO PYGL (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PYGL mRNA CTD PMID:37042841 Pygl Rat Triptolide decreases expression EXP 6480464 triptolide results in decreased expression of PYGL mRNA CTD PMID:23639586 Pygl Rat troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of PYGL mRNA and troglitazone results in decreased expression of PYGL protein CTD PMID:21315101 and PMID:21515302 Pygl Rat tungsten decreases expression ISO Pygl (Mus musculus) 6480464 Tungsten results in decreased expression of PYGL mRNA CTD PMID:30912803 Pygl Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of PYGL mRNA CTD PMID:24136188 Pygl Rat valproic acid increases expression ISO Pygl (Mus musculus) 6480464 Valproic Acid results in increased expression of PYGL mRNA CTD PMID:21427059 Pygl Rat valproic acid affects expression ISO PYGL (Homo sapiens) 6480464 Valproic Acid affects the expression of PYGL mRNA CTD PMID:25979313 Pygl Rat valproic acid multiple interactions ISO PYGL (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PYGL mRNA CTD PMID:27188386 Pygl Rat valproic acid increases expression ISO PYGL (Homo sapiens) 6480464 Valproic Acid results in increased expression of PYGL mRNA CTD PMID:19101580 more ... Pygl Rat vanillin affects binding ISO PYGL (Homo sapiens) 6480464 vanillin binds to PYGL protein CTD PMID:33823243 Pygl Rat vorinostat multiple interactions ISO PYGL (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PYGL mRNA CTD PMID:27188386 Pygl Rat vorinostat increases expression ISO PYGL (Homo sapiens) 6480464 vorinostat results in increased expression of PYGL mRNA CTD PMID:26272509 Pygl Rat zoledronic acid decreases expression ISO PYGL (Homo sapiens) 6480464 zoledronic acid results in decreased expression of PYGL mRNA CTD PMID:25596134
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,1-dichloroethene (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 1H-pyrazole (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3-chloropropane-1,2-diol (EXP) 3H-1,2-dithiole-3-thione (EXP) 4'-hydroxyacetophenone (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) 8-Br-cAMP (ISO) acetylsalicylic acid (EXP) acrylamide (EXP) acrylamides (ISO) actinomycin D (ISO) aldehydo-D-glucose (EXP) alpha-Zearalanol (EXP) aluminium phosphide (EXP) alvocidib (ISO) amiodarone (EXP) ammonium chloride (EXP) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (ISO) baicalein (ISO) benzamide (ISO) benzbromarone (EXP) benzo[a]pyrene (EXP,ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) buspirone (EXP) cadmium dichloride (ISO) Calcimycin (EXP) calcium atom (EXP) calcium(0) (EXP) carbon nanotube (ISO) chlordecone (ISO) chloroacetaldehyde (ISO) chloroacetic acid (ISO) chloroform (EXP) chloropicrin (ISO) ciguatoxin CTX1B (ISO) cisplatin (ISO) clofibrate (EXP) cobalt dichloride (EXP) copper(II) sulfate (ISO) Cuprizon (EXP) cyclosporin A (EXP,ISO) D-glucose (EXP) DDE (ISO) dexamethasone (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) dichlorvos (EXP) Diosbulbin B (ISO) dioxygen (EXP,ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) entinostat (ISO) erythromycin estolate (EXP) fenofibrate (EXP) furfural (ISO) Geniposide (EXP) glafenine (EXP) glucose (EXP) glyphosate (ISO) ibuprofen (EXP) ifosfamide (ISO) isoprenaline (EXP) ivermectin (ISO) ketoconazole (EXP) L-ethionine (EXP) malathion (EXP) metformin (EXP) methylarsonite (ISO) methylmercury chloride (ISO) Muraglitazar (EXP) N-acetyl-L-cysteine (EXP) N-nitrosomorpholine (EXP) nefazodone (EXP) neostigmine (EXP) nickel dichloride (EXP) nicotinamide (EXP) nimesulide (EXP) nitrofen (EXP) Nutlin-3 (ISO) omeprazole (EXP) orotic acid (EXP) ozone (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluorooctanoic acid (EXP) phentolamine (EXP) phenylephrine (EXP) pirinixic acid (EXP) potassium chromate (ISO) procyanidin B1 (ISO) pyrogallol (ISO) rac-lactic acid (ISO) resveratrol (EXP) rotenone (EXP,ISO) SB 431542 (ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium dichromate (EXP) streptozocin (EXP) sunitinib (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) Tesaglitazar (EXP) testosterone (ISO) tetrachloromethane (EXP,ISO) tetracycline (EXP) thimerosal (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) Triptolide (EXP) troglitazone (EXP) tungsten (ISO) valdecoxib (EXP) valproic acid (ISO) vanillin (ISO) vorinostat (ISO) zoledronic acid (ISO)
1.
High frequency of missense mutations in glycogen storage disease type VI.
Beauchamp NJ, etal., J Inherit Metab Dis. 2007 Oct;30(5):722-34. Epub 2007 Aug 21.
2.
Development of potent, orally active 1-substituted-3,4-dihydro-2-quinolone glycogen phosphorylase inhibitors.
Birch AM, etal., Bioorg Med Chem Lett. 2007 Jan 15;17(2):394-9. Epub 2006 Oct 19.
3.
Modulation of glycogen phosphorylase activity affects 5-phosphoribosyl-1-pyrophosphate availability in rat hepatocyte cultures.
Boer P and Sperling O, Nucleosides Nucleotides Nucleic Acids. 2004 Oct;23(8-9):1235-9.
4.
Structural relationships among regulated and unregulated phosphorylases.
Buchbinder JL, etal., Annu Rev Biophys Biomol Struct. 2001;30:191-209.
5.
Glucose has to be phosphorylated to activate glycogen synthase, but not to inactivate glycogen phosphorylase in hepatocytes.
Carabaza A, etal., FEBS Lett. 1992 Jan 20;296(2):211-4.
6.
Identification of a mutation in liver glycogen phosphorylase in glycogen storage disease type VI.
Chang S, etal., Hum Mol Genet. 1998 May;7(5):865-70.
7.
Liver glycogen storage diseases due to phosphorylase system deficiencies: diagnosis thanks to non invasive blood enzymatic and molecular studies.
Davit-Spraul A, etal., Mol Genet Metab. 2011 Sep-Oct;104(1-2):137-43. doi: 10.1016/j.ymgme.2011.05.010. Epub 2011 May 17.
8.
Regulation of rat hepatocyte function by P2Y receptors: focus on control of glycogen phosphorylase and cyclic AMP by 2-methylthioadenosine 5'-diphosphate.
Dixon CJ, etal., J Pharmacol Exp Ther. 2004 Oct;311(1):334-41. Epub 2004 May 19.
9.
Evidence against glycogen cycling of gluconeogenic substrates in various liver preparations.
Fosgerau K, etal., J Biol Chem 2002 Aug 9;277(32):28648-55.
10.
The gene encoding rat liver glycogen phosphorylase contains multiple polyadenylation signal sequences.
Froman BE, etal., Gene 1991 Dec 30;109(2):269-74.
11.
Defect in glucokinase translocation in Zucker diabetic fatty rats.
Fujimoto Y, etal., Am J Physiol Endocrinol Metab. 2004 Sep;287(3):E414-23. Epub 2004 May 11.
12.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
13.
Localization of the muscle, liver, and brain glycogen phosphorylase genes on linkage maps of mouse chromosomes 19, 12, and 2, respectively.
Glaser T, etal., Genomics 1989 Oct;5(3):510-21.
14.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
15.
Rapid activation of glycogen phosphorylase by steroid hormones in cultured rat hepatocytes.
Gomez-Munoz A, etal., Biochem J. 1989 Sep 1;262(2):417-23.
16.
Glycogen phosphorylase: control by phosphorylation and allosteric effectors.
Johnson LN FASEB J. 1992 Mar;6(6):2274-82.
17.
Glycogen synthesis by rat hepatocytes.
Katz J, etal., Biochem J. 1979 May 15;180(2):389-402.
18.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
19.
Response of glucose metabolism enzymes in an acute porphyria model. Role of reactive oxygen species.
Lelli SM, etal., Toxicology. 2005 Dec;216(1):49-58. Epub 2005 Aug 24.
20.
Glycogen phosphorylase isoenzymes from hepatoma 3924A and from a non-tumorigenic liver cell line. Comparison with the liver and brain enzymes.
Mayer D, etal., Biochem J. 1992 Mar 15;282 ( Pt 3):665-73.
21.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
22.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
23.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
24.
Isolation of partial cDNAs for rat liver and muscle glycogen phosphorylase isozymes.
Osawa S, etal., FEBS Lett 1986 Jul 7;202(2):282-8.
25.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
26.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
27.
GOA pipeline
RGD automated data pipeline
28.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
29.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
30.
Effects of the specific cAMP antagonist, (Rp)-adenosine cyclic 3',5'-phosphorothioate, on the cAMP-dependent protein kinase-induced activity of hepatic glycogen phosphorylase and glycogen synthase.
Rothermel JD, etal., J Biol Chem. 1984 Dec 25;259(24):15294-300.
31.
Glycogen-binding protein components of rat tissues.
Satoh K and Sato K, Biochem Biophys Res Commun. 1980 Sep 16;96(1):28-33.
32.
Electron microscopical study of a cytosolic enzyme in unfixed cryostat sections: demonstration of glycogen phosphorylase activity in rat liver and heart tissue.
Schellens JP, etal., Histochem J. 1995 Aug;27(8):609-14.
33.
The nucleotide sequence of rat liver glycogen phosphorylase cDNA.
Schiebel K, etal., Biochim Biophys Acta 1992 Apr 6;1130(3):349-51.
34.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
35.
Proteomic investigation of signatures for geniposide-induced hepatotoxicity.
Wei J, etal., J Proteome Res. 2014 Dec 5;13(12):5724-33. doi: 10.1021/pr5007119. Epub 2014 Oct 30.
Pygl Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 94,433,558 - 94,476,219 (-) NCBI GRCr8 mRatBN7.2 6 88,697,598 - 88,740,260 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 88,697,593 - 88,740,310 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 89,096,834 - 89,133,820 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 89,396,285 - 89,433,272 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 88,835,817 - 88,872,806 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 92,597,759 - 92,643,734 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 92,597,706 - 92,643,847 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 102,045,144 - 102,091,119 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 92,298,339 - 92,341,347 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 92,301,796 - 92,344,803 (-) NCBI Celera 6 87,191,869 - 87,228,313 (-) NCBI Celera Cytogenetic Map 6 q24 NCBI
PYGL Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 50,905,217 - 50,944,483 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 50,857,891 - 50,944,483 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 51,371,935 - 51,411,201 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 50,441,687 - 50,480,984 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 50,441,688 - 50,480,984 NCBI Celera 14 31,238,983 - 31,278,301 (-) NCBI Celera Cytogenetic Map 14 q22.1 NCBI HuRef 14 31,497,509 - 31,536,798 (-) NCBI HuRef CHM1_1 14 51,310,446 - 51,349,770 (-) NCBI CHM1_1 T2T-CHM13v2.0 14 45,111,656 - 45,150,908 (-) NCBI T2T-CHM13v2.0
Pygl Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 70,237,589 - 70,274,457 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 70,237,585 - 70,278,262 (-) Ensembl GRCm39 Ensembl GRCm38 12 70,190,815 - 70,227,683 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 70,190,811 - 70,231,488 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 71,291,802 - 71,328,670 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 71,109,416 - 71,146,222 (-) NCBI MGSCv36 mm8 Celera 12 71,292,479 - 71,327,360 (-) NCBI Celera Cytogenetic Map 12 C2 NCBI cM Map 12 29.01 NCBI
Pygl Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955409 11,970,112 - 12,007,102 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955409 11,970,112 - 12,007,102 (+) NCBI ChiLan1.0 ChiLan1.0
PYGL Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 52,042,469 - 52,082,068 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 51,234,331 - 51,299,970 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 31,494,172 - 31,533,545 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 49,793,210 - 49,832,786 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 49,746,309 - 49,832,786 (-) Ensembl panpan1.1 panPan2
PYGL Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 27,264,778 - 27,307,977 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 27,223,273 - 27,307,977 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 27,018,142 - 27,061,230 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 27,443,863 - 27,486,861 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 27,401,678 - 27,486,986 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 27,098,985 - 27,141,894 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 27,171,662 - 27,214,570 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 27,519,107 - 27,562,008 (-) NCBI UU_Cfam_GSD_1.0
Pygl Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 59,463,043 - 59,498,992 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936495 14,692,332 - 14,730,231 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936495 14,692,688 - 14,728,663 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PYGL Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 180,620,314 - 180,719,979 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 180,645,849 - 180,704,124 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 200,933,155 - 200,991,988 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PYGL Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 27,987,676 - 28,030,919 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 27,987,649 - 28,030,869 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 16,283,872 - 16,325,710 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pygl
.
Predicted Target Of
Count of predictions: 9 Count of miRNA genes: 9 Interacting mature miRNAs: 9 Transcripts: ENSRNOT00000009183 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1331799 Bp211 Blood pressure QTL 211 3.66407 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 72202632 130919985 Rat 634330 Pia16 Pristane induced arthritis QTL 16 3.9 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 6 45790088 104200226 Rat 1331789 Rf37 Renal function QTL 37 3.224 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 6 72202632 115200186 Rat 4145119 Mcs25 Mammary carcinoma susceptibility QTL 25 0.0001 mammary gland integrity trait (VT:0010552) ratio of deaths to total study population during a period of time (CMO:0001023) 6 10894415 110548006 Rat 70176 Mcsm1 Mammary carcinoma susceptibility modifier QTL 1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 58632962 103632962 Rat 1581563 Uae33 Urinary albumin excretion QTL 33 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 72227641 130729205 Rat 10054138 Gmadr3 Adrenal mass QTL 3 3.68 0.00045 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 6 85140138 130140138 Rat 1558641 Cm47 Cardiac mass QTL 47 2.9 0.001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 6 57730540 104085867 Rat 724524 Uae2 Urinary albumin excretion QTL 2 2.7 0.0005 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 73463459 109394713 Rat 737827 Hcar11 Hepatocarcinoma resistance QTL 11 4.4 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 6 82523650 110548006 Rat 1641904 Alcrsp4 Alcohol response QTL 4 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 6 67262953 112262953 Rat 724513 Uae14 Urinary albumin excretion QTL 14 6.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 85311061 133478515 Rat 2303624 Vencon5 Ventilatory control QTL 5 4.45 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 6 88047916 133047916 Rat 1576309 Emca7 Estrogen-induced mammary cancer QTL 7 4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 15107216 107351382 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 2293837 Kiddil1 Kidney dilation QTL 1 3.7 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 81132889 104393926 Rat 2293842 Kiddil3 Kidney dilation QTL 3 4.3 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 81132889 104393926 Rat 4889848 Pur25 Proteinuria QTL 25 14 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 56728562 90198260 Rat 10054123 Srcrt6 Stress Responsive Cort QTL 6 2.5 0.0043 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 85140138 130140138 Rat 724536 Uae7 Urinary albumin excretion QTL 7 3.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 72202632 130729475 Rat 70196 BpQTLcluster7 Blood pressure QTL cluster 7 6.82 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 72202632 117202632 Rat 1581550 Pur8 Proteinuria QTL 8 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 72227641 130729205 Rat 1576302 Schws4 Schwannoma susceptibility QTL 4 0.0078 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 83190345 106747639 Rat 1300075 Glom7 Glomerulus QTL 7 5.6 0.0000002 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 6 71201409 116201409 Rat 738034 Anxrr5 Anxiety related response QTL 5 5.9 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 6 84130881 129130881 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 12801471 Schws9 Schwannoma susceptibility QTL 9 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 61747639 106747639 Rat 6893332 Cm74 Cardiac mass QTL 74 0.4 0.64 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 6 57730540 104085867 Rat 1300076 Glom8 Glomerulus QTL 8 7 9e-09 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 6 86894788 131894788 Rat
RH131951
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 2,223,328 - 2,223,512 (+) MAPPER mRatBN7.2 Rnor_6.0 6 92,629,544 - 92,629,727 NCBI Rnor6.0 Rnor_6.0 14 3,240,565 - 3,240,748 NCBI Rnor6.0 Rnor_5.0 14 3,241,157 - 3,241,340 UniSTS Rnor5.0 Rnor_5.0 6 102,076,929 - 102,077,112 UniSTS Rnor5.0 RGSC_v3.4 14 2,781,150 - 2,781,333 UniSTS RGSC3.4 Celera 14 2,241,986 - 2,242,169 UniSTS RH 3.4 Map 14 37.2 UniSTS Cytogenetic Map 14 p22 UniSTS Cytogenetic Map 6 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000009183 ⟹ ENSRNOP00000009183
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 88,697,593 - 88,740,310 (-) Ensembl Rnor_6.0 Ensembl 6 92,597,706 - 92,643,847 (-) Ensembl
RefSeq Acc Id:
NM_022268 ⟹ NP_071604
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 94,433,558 - 94,476,219 (-) NCBI mRatBN7.2 6 88,697,598 - 88,740,260 (-) NCBI Rnor_6.0 6 92,597,759 - 92,643,734 (-) NCBI Rnor_5.0 6 102,045,144 - 102,091,119 (-) NCBI RGSC_v3.4 6 92,298,339 - 92,341,347 (-) RGD Celera 6 87,191,869 - 87,228,313 (-) RGD
Sequence:
CCGCCACCCGCAACCATGGCGAAGCCCTTGACCGACCAGGAAAAGCGACGGCAGATCAGCATCCGCGGCATCGTGGGCGTGGAGAACGTAGCGGAGCTGAAAAAGGGCTTCAATCGTCACCTGCACTT
hide sequence
RefSeq Acc Id:
NP_071604 ⟸ NM_022268
- UniProtKB:
P09811 (UniProtKB/Swiss-Prot), A6HBY8 (UniProtKB/TrEMBL)
- Sequence:
MAKPLTDQEKRRQISIRGIVGVENVAELKKGFNRHLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDMEELEEIEE
hide sequence
Ensembl Acc Id:
ENSRNOP00000009183 ⟸ ENSRNOT00000009183
RGD ID: 13694644 Promoter ID: EPDNEW_R5166 Type: initiation region Name: Pygl_1 Description: glycogen phosphorylase L SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 92,643,810 - 92,643,870 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-11-18
Pygl
glycogen phosphorylase L
Pygl
phosphorylase, glycogen, liver
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-11-11
Pygl
phosphorylase, glycogen, liver
Pygl
liver glycogen phosphorylase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-02-26
Pygl
liver glycogen phosphorylase
Symbol and Name status set to approved
625702 APPROVED
2002-08-07
Pygl
liver glycogen phosphorylase
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_disease
inhibition of enzyme activity inhibits glyocogenolysis without altering gluconeogenesis and may have application to treatment of type 2 diabetes
729891
