Advanced Search (OLGA)

Gene: Il17b (interleukin 17B) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Il17b

Name:

interleukin 17B

RGD ID:

620614

Description:

Predicted to enable cytokine activity. Predicted to be involved in inflammatory response and signal transduction. Predicted to act upstream of or within positive regulation of cytokine production involved in inflammatory response. Predicted to be located in extracellular space. Orthologous to human IL17B (interleukin 17B); PARTICIPATES IN cytokine mediated signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 2,4,6-trinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

interleukin-17B

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	IL17B (interleukin 17B)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Il17b (interleukin 17B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Il17b (interleukin 17B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	IL17B (interleukin 17B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	IL17B (interleukin 17B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Il17b (interleukin 17B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	IL17B (interleukin 17B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	IL17B (interleukin 17B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Il17b (interleukin 17B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CDH24 (cadherin 24)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	IL17B (interleukin 17B)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Il17b (interleukin 17B)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	il17b	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	57,411,532 - 57,415,903 (+)	NCBI		GRCr8
mRatBN7.2	18	55,141,194 - 55,145,565 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	55,141,194 - 55,145,565 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	57,234,781 - 57,239,079 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	57,949,431 - 57,953,743 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	55,765,055 - 55,769,426 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	57,011,575 - 57,016,009 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	57,011,575 - 57,016,009 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	56,240,488 - 56,244,922 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	57,665,293 - 57,669,668 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	57,739,647 - 57,741,775 (+)	NCBI
Celera	18	53,290,941 - 53,295,289 (+)	NCBI		Celera
Cytogenetic Map	18	q12.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Il17b	Rat	familial adenomatous polyposis 1		ISO	IL17B (Homo sapiens)	8554872	ClinVar Annotator: match by term: Familial adenomatous polyposis 1	ClinVar	PMID:17963004 more ...
Il17b	Rat	Hereditary Neoplastic Syndromes		ISO	IL17B (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hereditary cancer-predisposing syndrome	ClinVar	PMID:17963004 more ...
Il17b	Rat	Keratoconus 1		ISO	IL17B (Homo sapiens)	8554872	ClinVar Annotator: match by term: Keratoconus 1	ClinVar
Il17b	Rat	Neurodevelopmental Disorders		ISO	IL17B (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Il17b	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of IL17B mRNA	CTD	PMID:33387578
Il17b	Rat	2,3,7,8-Tetrachlorodibenzofuran	decreases expression	EXP		6480464	2 more ...	CTD	PMID:32109520
Il17b	Rat	2,4,6-trinitrotoluene	affects expression	EXP		6480464	Trinitrotoluene affects the expression of IL17B mRNA	CTD	PMID:21346803
Il17b	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2 and 4-dinitrotoluene affects the expression of IL17B mRNA	CTD	PMID:21346803
Il17b	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2 and 6-dinitrotoluene affects the expression of IL17B mRNA	CTD	PMID:21346803
Il17b	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	Il17b (Mus musculus)	6480464	bisphenol S affects the methylation of IL17B gene	CTD	PMID:31683443
Il17b	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of IL17B mRNA	CTD	PMID:24780913
Il17b	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of IL17B mRNA	CTD	PMID:31881176
Il17b	Rat	Aflatoxin B2 alpha	decreases methylation	ISO	IL17B (Homo sapiens)	6480464	aflatoxin B2 results in decreased methylation of IL17B intron	CTD	PMID:30157460
Il17b	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of IL17B mRNA	CTD	PMID:16483693
Il17b	Rat	benzo[a]pyrene	increases methylation	ISO	IL17B (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of IL17B promoter	CTD	PMID:27901495
Il17b	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of IL17B mRNA	CTD	PMID:25181051 more ...
Il17b	Rat	cyclosporin A	increases expression	ISO	IL17B (Homo sapiens)	6480464	Cyclosporine results in increased expression of IL17B mRNA	CTD	PMID:25562108
Il17b	Rat	decabromodiphenyl ether	increases expression	EXP		6480464	decabromobiphenyl ether results in increased expression of IL17B mRNA	CTD	PMID:23914054
Il17b	Rat	ferulic acid	multiple interactions	ISO	Il17b (Mus musculus)	6480464	ferulic acid inhibits the reaction [Imiquimod results in decreased expression of IL17B mRNA]	CTD	PMID:31054998
Il17b	Rat	fipronil	decreases expression	EXP		6480464	fipronil results in decreased expression of IL17B mRNA	CTD	PMID:34044035
Il17b	Rat	fulvestrant	decreases methylation	ISO	IL17B (Homo sapiens)	6480464	Fulvestrant results in decreased methylation of IL17B gene	CTD	PMID:31601247
Il17b	Rat	genistein	decreases expression	EXP		6480464	Genistein results in decreased expression of IL17B mRNA	CTD	PMID:17341692
Il17b	Rat	genistein	decreases expression	ISO	Il17b (Mus musculus)	6480464	Genistein results in decreased expression of IL17B mRNA	CTD	PMID:32186404
Il17b	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of IL17B mRNA	CTD	PMID:33387578
Il17b	Rat	GW 4064	multiple interactions	ISO	Il17b (Mus musculus)	6480464	GW 4064 promotes the reaction [NR1H4 protein binds to IL17B gene]	CTD	PMID:20091679
Il17b	Rat	imiquimod	decreases expression	ISO	Il17b (Mus musculus)	6480464	Imiquimod results in decreased expression of IL17B mRNA	CTD	PMID:31054998
Il17b	Rat	imiquimod	multiple interactions	ISO	Il17b (Mus musculus)	6480464	ferulic acid inhibits the reaction [Imiquimod results in decreased expression of IL17B mRNA]	CTD	PMID:31054998
Il17b	Rat	N-methyl-N-nitrosourea	increases expression	EXP		6480464	Methylnitrosourea results in increased expression of IL17B mRNA	CTD	PMID:17341692
Il17b	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of IL17B mRNA	CTD	PMID:33387578
Il17b	Rat	paraquat	increases expression	ISO	Il17b (Mus musculus)	6480464	Paraquat results in increased expression of IL17B mRNA	CTD	PMID:22938100
Il17b	Rat	perfluorohexanesulfonic acid	multiple interactions	ISO	IL17B (Homo sapiens)	6480464	[perfluorooctanoic acid co-treated with perfluorooctane sulfonic acid co-treated with perfluorohexanesulfonic acid] results in increased expression of IL17B mRNA	CTD	PMID:38603627
Il17b	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	IL17B (Homo sapiens)	6480464	[perfluorooctanoic acid co-treated with perfluorooctane sulfonic acid co-treated with perfluorohexanesulfonic acid] results in increased expression of IL17B mRNA	CTD	PMID:38603627
Il17b	Rat	perfluorooctanoic acid	multiple interactions	ISO	IL17B (Homo sapiens)	6480464	[perfluorooctanoic acid co-treated with perfluorooctane sulfonic acid co-treated with perfluorohexanesulfonic acid] results in increased expression of IL17B mRNA	CTD	PMID:38603627
Il17b	Rat	rotenone	increases expression	ISO	IL17B (Homo sapiens)	6480464	Rotenone results in increased expression of IL17B mRNA	CTD	PMID:29955902
Il17b	Rat	silicon dioxide	decreases expression	ISO	IL17B (Homo sapiens)	6480464	Silicon Dioxide analog results in decreased expression of IL17B mRNA	CTD	PMID:25895662
Il17b	Rat	sodium arsenite	decreases expression	ISO	Il17b (Mus musculus)	6480464	sodium arsenite results in decreased expression of IL17B mRNA	CTD	PMID:37682722
Il17b	Rat	sterigmatocystin	increases expression	ISO	Il17b (Mus musculus)	6480464	Sterigmatocystin results in increased expression of IL17B mRNA	CTD	PMID:19818335
Il17b	Rat	sunitinib	increases expression	ISO	IL17B (Homo sapiens)	6480464	Sunitinib results in increased expression of IL17B mRNA	CTD	PMID:31533062
Il17b	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of IL17B mRNA	CTD	PMID:34492290
Il17b	Rat	titanium dioxide	decreases methylation	ISO	Il17b (Mus musculus)	6480464	titanium dioxide results in decreased methylation of IL17B gene	CTD	PMID:35295148
Il17b	Rat	TMC-120A	decreases expression	ISO	Il17b (Mus musculus)	6480464	TMC 120A results in decreased expression of IL17B mRNA	CTD	PMID:19818335
Il17b	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of IL17B mRNA	CTD	PMID:33387578
Il17b	Rat	urethane	decreases expression	ISO	IL17B (Homo sapiens)	6480464	Urethane results in decreased expression of IL17B mRNA	CTD	PMID:28818685
Il17b	Rat	valproic acid	affects expression	ISO	Il17b (Mus musculus)	6480464	Valproic Acid affects the expression of IL17B mRNA	CTD	PMID:17963808
Il17b	Rat	vinclozolin	decreases expression	EXP		6480464	vinclozolin results in decreased expression of IL17B mRNA	CTD	PMID:18629315

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Il17b	Rat	inflammatory response	involved_in	IEA	InterPro:IPR020440	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Il17b	Rat	positive regulation of cytokine production involved in inflammatory response	acts_upstream_of_or_within	ISO	Il17b (Mus musculus)	1624291	PMID:17982105	RGD	PMID:17982105
Il17b	Rat	signal transduction	involved_in	IEA	GO:0005125	1600115	GO_REF:0000108	GOC	GO_REF:0000108

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Il17b	Rat	extracellular region	located_in	IEA	UniProtKB-KW:KW-0964	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Il17b	Rat	extracellular region	located_in	IEA	UniProtKB-SubCell:SL-0243	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Il17b	Rat	extracellular region	located_in	IEA	InterPro:IPR010345 and InterPro:IPR020440	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Il17b	Rat	extracellular space	located_in	IEA	UniProtKB-KW:KW-0202	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Il17b	Rat	cytokine activity	enables	IEA	UniProtKB-KW:KW-0202	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Il17b	Rat	cytokine activity	enables	IEA	InterPro:IPR010345 and InterPro:IPR020440	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Il17b	Rat	cytokine activity	enables	ISO	Il17b (Mus musculus)	1624291	PMID:17982105	RGD	PMID:17982105

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Il17b	Rat	cytokine mediated signaling pathway		IEA		6907045		KEGG	rno:04060

#	Reference Title	Reference Citation
1.	Cloning and characterization of IL-17B and IL-17C, two new members of the IL-17 cytokine family.	Li H, etal., Proc Natl Acad Sci U S A 2000 Jan 18;97(2):773-8.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:17982105

Il17b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	57,411,532 - 57,415,903 (+)	NCBI		GRCr8
mRatBN7.2	18	55,141,194 - 55,145,565 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	55,141,194 - 55,145,565 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	57,234,781 - 57,239,079 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	57,949,431 - 57,953,743 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	55,765,055 - 55,769,426 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	57,011,575 - 57,016,009 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	57,011,575 - 57,016,009 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	56,240,488 - 56,244,922 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	57,665,293 - 57,669,668 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	57,739,647 - 57,741,775 (+)	NCBI
Celera	18	53,290,941 - 53,295,289 (+)	NCBI		Celera
Cytogenetic Map	18	q12.1	NCBI

IL17B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	149,374,267 - 149,404,202 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	149,371,324 - 149,404,202 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	148,753,830 - 148,783,765 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	148,734,023 - 148,739,031 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	148,734,024 - 148,739,031	NCBI
Celera	5	144,835,805 - 144,840,813 (-)	NCBI		Celera
Cytogenetic Map	5	q32	NCBI
HuRef	5	143,900,155 - 143,905,163 (-)	NCBI		HuRef
CHM1_1	5	148,186,259 - 148,191,267 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	149,909,114 - 149,939,047 (-)	NCBI		T2T-CHM13v2.0

Il17b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	61,821,006 - 61,825,609 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	61,817,958 - 61,825,609 (+)	Ensembl		GRCm39 Ensembl
GRCm38	18	61,687,935 - 61,692,538 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	61,684,887 - 61,692,538 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	61,847,589 - 61,852,191 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	61,813,304 - 61,817,906 (+)	NCBI		MGSCv36	mm8
Celera	18	62,970,900 - 62,975,972 (+)	NCBI		Celera
Cytogenetic Map	18	E1	NCBI
cM Map	18	34.67	NCBI

Il17b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	5,041,375 - 5,047,449 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955415	5,037,270 - 5,047,405 (+)	NCBI	ChiLan1.0	ChiLan1.0

IL17B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	144,604,299 - 144,607,629 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	142,743,848 - 142,763,536 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	144,800,664 - 144,842,788 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	150,811,055 - 150,840,085 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	150,811,055 - 150,815,930 (-)	Ensembl	panpan1.1		panPan2

IL17B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	59,578,568 - 59,584,069 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	59,543,080 - 59,583,968 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	59,341,309 - 59,352,992 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	60,058,822 - 60,070,520 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	60,060,397 - 60,066,539 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	59,845,455 - 59,857,144 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	59,960,072 - 59,971,763 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	60,490,476 - 60,502,167 (+)	NCBI		UU_Cfam_GSD_1.0

Il17b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	143,908,738 - 143,915,822 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936504	5,482,972 - 5,489,899 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936504	5,485,009 - 5,489,788 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

IL17B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	150,541,180 - 150,545,367 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	150,513,611 - 150,583,640 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	157,279,046 - 157,349,566 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

IL17B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	51,992,877 - 52,001,280 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	51,993,258 - 51,998,043 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666034	25,748,904 - 25,753,870 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Il17b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624774	8,732,471 - 8,739,331 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624774	8,733,264 - 8,763,150 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Il17b
65 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	34
Count of miRNA genes:	32
Interacting mature miRNAs:	34
Transcripts:	ENSRNOT00000026679
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	24796977	79788953	Rat
1358358	Sradr6	Stress Responsive Adrenal Weight QTL 6	2.49		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	18	11944299	59330563	Rat
1331730	Scl27	Serum cholesterol level QTL 27	3.826		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	18	52292875	59796643	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	21372893	83213037	Rat
1331742	Bp228	Blood pressure QTL 228	3.88752		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	59796643	Rat
1298072	Cia26	Collagen induced arthritis QTL 26	3.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	54709769	83828827	Rat
1331736	Bp227	Blood pressure QTL 227	2.791		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	46718763	59796643	Rat
1300125	Rf26	Renal function QTL 26	3.2		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	18	52539863	65844950	Rat
6893683	Bw110	Body weight QTL 110	2.7	0.002	body mass (VT:0001259)	body weight (CMO:0000012)	18	43345022	83828827	Rat
1331727	Bp237	Blood pressure QTL 237	3.053		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	61698465	Rat
9589041	Epfw12	Epididymal fat weight QTL 12	17.08	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	18	46640675	83828827	Rat
8694432	Bw165	Body weight QTL 165	3.81	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	46640675	83828827	Rat
9589816	Gluco68	Glucose level QTL 68	7.25	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	29792965	74792965	Rat
1331774	Bp226	Blood pressure QTL 226	4.41065		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	59796643	Rat
61360	Eaey	Experimental allergic encephalomyelitis QTL y	3		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis duration (CMO:0001424)	18	46988939	60377753	Rat
2300177	Bmd65	Bone mineral density QTL 65	19.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	11791518	83218561	Rat
2303120	Mamtr8	Mammary tumor resistance QTL 8		0.001	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	31359408	83218561	Rat
12880368	Bw187	Body weight QTL 187		0.045	body mass (VT:0001259)	body weight (CMO:0000012)	18	52539763	76104388	Rat
61367	Iddm4	Insulin dependent diabetes mellitus QTL 4	2.33	0.0074	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	38192455	83192455	Rat
2293658	Bmd23	Bone mineral density QTL 23	7.3	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	18	51464733	63636873	Rat
1359020	Ppulsi2	Prepulse inhibition QTL 2	2.71		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	18	52292875	73997283	Rat
2299160	Iddm35	Insulin dependent diabetes mellitus QTL 35	2.79		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	18	4207941	60377792	Rat
9590318	Scort22	Serum corticosterone level QTL 22	7.64	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	18	29792965	74792965	Rat
1331752	Bw27	Body weight QTL 27	2.963		body mass (VT:0001259)	body weight (CMO:0000012)	18	52292875	65845095	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	11791518	83218561	Rat
1331754	Bp230	Blood pressure QTL 230	4.61609		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	29792965	74792965	Rat
12904069	Cm123	Cardiac mass QTL 123		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	52539763	76104388	Rat
1331798	Bp224	Blood pressure QTL 224	3.53873		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	59796643	Rat
12904070	Cm124	Cardiac mass QTL 124		0.01	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	52539763	76104388	Rat
2303584	Gluco55	Glucose level QTL 55	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	18	48520044	83828827	Rat
12904071	Am18	Aortic mass QTL 18		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	52539763	76104388	Rat
61383	Bp47	Blood pressure QTL 47	17.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	31271681	60377755	Rat
12904067	Cm122	Cardiac mass QTL 122		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	52539763	76104388	Rat
1331806	Bp229	Blood pressure QTL 229	4.36484		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	46718763	57867167	Rat
2301417	Bp319	Blood pressure QTL 319		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	52539763	76104388	Rat
12904073	Kidm71	Kidney mass QTL 71		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	52539763	76104388	Rat
1331780	Bp238	Blood pressure QTL 238	3.269		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	46718763	59796643	Rat
738008	Hcar14	Hepatocarcinoma resistance QTL 14	4.3		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion number (CMO:0001462)	18	51464733	83218561	Rat
1331776	Bp225	Blood pressure QTL 225	2.829		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	31359408	59796643	Rat
6903359	Bp355	Blood pressure QTL 355	3.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944544	59796478	Rat
631518	Bw11	Body weight QTL 11	2.8		body mass (VT:0001259)	body weight (CMO:0000012)	18	35870723	80870723	Rat
6903345	Bp349	Blood pressure QTL 349	3.9		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	46718935	59796478	Rat
2313082	Bss85	Bone structure and strength QTL 85	0.8	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	18	14951337	59951337	Rat
6903347	Bp350	Blood pressure QTL 350	4.4		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359530	59796478	Rat
8694366	Abfw8	Abdominal fat weight QTL 8	6.38	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	18	46640675	83828827	Rat
6903349	Bp351	Blood pressure QTL 351	3.5		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	46718935	59796478	Rat
631509	Sald2	Serum aldosterone level QTL 2	2.9		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	18	52539763	69140759	Rat
2300157	Bmd66	Bone mineral density QTL 66	13.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
738005	Anxrr11	Anxiety related response QTL 11	3.4		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	18	30039813	75039813	Rat
6903351	Bp352	Blood pressure QTL 352	3.3		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	46718935	59796478	Rat
631274	Sprol1	Serum protein level QTL 1	5.3		blood total protein amount (VT:0005567)	serum total protein level (CMO:0000661)	18	31393320	77209694	Rat
1358193	Emca2	Estrogen-induced mammary cancer QTL 2	1.6		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	18	18007599	63571040	Rat
2293704	Bss35	Bone structure and strength QTL 35	4.59	0.0002	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	18	28964853	73964853	Rat
2325839	Bp348	Blood pressure QTL 348		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25570985	70570985	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19278901	83218561	Rat
2293708	Bss46	Bone structure and strength QTL 46	8.8	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	18	11791518	63636873	Rat
8694378	Bw157	Body weight QTL 157	3.59	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	29792965	74792965	Rat
1600375	Mcs22	Mammary carcinoma susceptibility QTL 22	3.3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	52539763	63933058	Rat
2303571	Bw92	Body weight QTL 92	3		body mass (VT:0001259)	body weight (CMO:0000012)	18	48520044	83828827	Rat
1598826	Anxrr20	Anxiety related response QTL 20	3.04		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	18	41432971	83828827	Rat
61429	Cia17	Collagen induced arthritis QTL 17	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	31359408	70263868	Rat
7411719	Strs5	Sensitivity to stroke QTL 5	9.4		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	18	49999958	65845095	Rat

BI274883

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	55,145,280 - 55,145,489 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	57,015,725 - 57,015,933	NCBI	Rnor6.0
Rnor_5.0	18	56,244,638 - 56,244,846	UniSTS	Rnor5.0
RGSC_v3.4	18	57,669,384 - 57,669,592	UniSTS	RGSC3.4
Celera	18	53,295,005 - 53,295,213	UniSTS
RH 3.4 Map	18	541.8	UniSTS
Cytogenetic Map	18	q12.1	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	5	40	36	56	71	40	19	40	6	147	65	29	30	51	31


RefSeq Transcripts	NM_053789	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017600811	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096542	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096543	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF218724	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473971	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000026679 ⟹ ENSRNOP00000026679

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	55,141,194 - 55,145,565 (+)	Ensembl
Rnor_6.0 Ensembl	18	57,011,575 - 57,016,009 (+)	Ensembl

RefSeq Acc Id:

NM_053789 ⟹ NP_446241

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	57,411,532 - 57,415,903 (+)	NCBI
mRatBN7.2	18	55,141,194 - 55,145,565 (+)	NCBI
Rnor_6.0	18	57,011,575 - 57,016,009 (+)	NCBI
Rnor_5.0	18	56,240,488 - 56,244,922 (+)	NCBI
RGSC_v3.4	18	57,665,293 - 57,669,668 (+)	RGD
Celera	18	53,290,941 - 53,295,289 (+)	RGD

Sequence:

show sequence

GGGGTTCCTGGCCGGTGGCAGCTGCAGGCTGACTTAATGGGATGGACTGGCCACACAGCCTGCTCTTCCTTCTTGCCATCTCCATCTTCCTGGTGCCAAGCCAGCCCCGGAACACCAAAGGCAAAAGG
AAGGGGCAAGGGAGGCCTGGCCCCTTGGCCCCTGGGCCTCACCAGGTGCCGCTGGACCTGGTGTCTCGAGTAAAGCCCTACGCCCGAATGGAAGAGTACGAGAGGAACCTTGGCGAGATGGTGGCCCA
GCTGAGGAACAGCTCTGAGCCAGCCAAGAAGAAGTGTGAAGTCAACTTGCAGCTGTGGTTATCCAACAAGAGAAGCCTGTCTCCCTGGGGCTACAGCATCAATCACGACCCCAGCCGCATCCCGGAGG
ACTTGCCTGAGGCGCGGTGCCTATGTTTGGGTTGCGTGAACCCCTTCACCATGCAGGAGGACCGTAGCATGGTGAGCGTGCCAGTGTTCAGCCAGGTGCCAGTGCGCCGCCGCCTCTGTCCGCAACCT
CCTCGGCCCGGGCCCTGCCGCCAGCGTGTTGTCATGGAGACCATCGCTGTGGGTTGCACCTGCATCTTCTGAGCCACCAACCCTCAACCAGGTGGCTACTGCAACGATCCTCCCTCCCTGCACCCACT
GTGACCCTCAAGGCTGATAAACAGTAAACGTTGTTCTTTGTAAAGGAA

hide sequence

RefSeq Acc Id:

XM_039096542 ⟹ XP_038952470

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	57,412,083 - 57,415,903 (+)	NCBI
mRatBN7.2	18	55,141,743 - 55,145,565 (+)	NCBI

RefSeq Acc Id:

XM_039096543 ⟹ XP_038952471

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	57,411,667 - 57,415,903 (+)	NCBI
mRatBN7.2	18	55,141,329 - 55,145,565 (+)	NCBI


Protein RefSeqs	NP_446241	(Get FASTA)	NCBI Sequence Viewer
	XP_038952470	(Get FASTA)	NCBI Sequence Viewer
	XP_038952471	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG44133	(Get FASTA)	NCBI Sequence Viewer
	EDM14615	(Get FASTA)	NCBI Sequence Viewer
	EDM14616	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000026679
	ENSRNOP00000026679.5

RefSeq Acc Id:	NP_446241 ⟸ NM_053789
- Peptide Label:	precursor
- UniProtKB:	G3V8K9 (UniProtKB/TrEMBL), A6IXI4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MDWPHSLLFLLAISIFLVPSQPRNTKGKRKGQGRPGPLAPGPHQVPLDLVSRVKPYARMEEYERNLGEMVAQLRNSSEPAKKKCEVNLQLWLSNKRSLSPWGYSINHDPSRIPEDLPEARCLCLGCVN PFTMQEDRSMVSVPVFSQVPVRRRLCPQPPRPGPCRQRVVMETIAVGCTCIF hide sequence

Ensembl Acc Id:

ENSRNOP00000026679 ⟸ ENSRNOT00000026679

RefSeq Acc Id:	XP_038952471 ⟸ XM_039096543
- Peptide Label:	isoform X1
- UniProtKB:	A6IXI5 (UniProtKB/TrEMBL), Q9EQI7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038952470 ⟸ XM_039096542
- Peptide Label:	isoform X1
- UniProtKB:	A6IXI5 (UniProtKB/TrEMBL), Q9EQI7 (UniProtKB/TrEMBL)

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V8K9-F1-model_v2	AlphaFold	G3V8K9	1-180	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13700818

Promoter ID:

EPDNEW_R11342

Type:

single initiation site

Name:

Il17b_1

Description:

interleukin 17B

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	18	57,011,555 - 57,011,615	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-7306	BioCyc
Ensembl Genes	ENSRNOG00000019695	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000026679	ENTREZGENE
	ENSRNOT00000026679.7	UniProtKB/TrEMBL
Gene3D-CATH	2.10.90.10	UniProtKB/TrEMBL
InterPro	Cystine-knot_cytokine	UniProtKB/TrEMBL
	Interleukin-17_chordata	UniProtKB/TrEMBL
	Interleukin-17_met	UniProtKB/TrEMBL
KEGG Report	rno:116472	UniProtKB/TrEMBL
NCBI Gene	116472	ENTREZGENE
Pfam	IL17	UniProtKB/TrEMBL
PhenoGen	Il17b	PhenoGen
PRINTS	INTRLEUKIN17	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000019695	RatGTEx
Superfamily-SCOP	SSF57501	UniProtKB/TrEMBL
UniProt	A6IXI4	ENTREZGENE, UniProtKB/TrEMBL
	A6IXI5	ENTREZGENE, UniProtKB/TrEMBL
	G3V8K9	ENTREZGENE, UniProtKB/TrEMBL
	Q9EQI7	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Il17b	interleukin 17B			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Il17b	interleukin 17B			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)