Advanced Search (OLGA)

Gene: Xcl1 (X-C motif chemokine ligand 1) Rattus norvegicus

Analyze

Symbol:

Xcl1

Name:

X-C motif chemokine ligand 1

RGD ID:

620452

Description:

Predicted to enable CCR chemokine receptor binding activity; chemokine activity; and protein homodimerization activity. Predicted to be involved in several processes, including positive regulation of leukocyte migration; regulation of alpha-beta T cell activation; and regulation of gene expression. Predicted to act upstream of or within chemotaxis; establishment of localization in cell; and release of sequestered calcium ion into cytosol. Predicted to be located in extracellular region. Predicted to be active in extracellular space. Biomarker of anti-basement membrane glomerulonephritis. Orthologous to several human genes including XCL1 (X-C motif chemokine ligand 1); PARTICIPATES IN chemokine mediated signaling pathway; INTERACTS WITH 1,2,4-trimethylbenzene; 1,2-dimethylhydrazine; 1-naphthyl isothiocyanate.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

c motif chemokine 1; chemokine (C motif) ligand 1; cytokine SCM-1; Ltn; lymphotactin; Scyc1; small inducible cytokine subfamily C, member 1 (lymphotactin); small-inducible cytokine C1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	XCL1 (X-C motif chemokine ligand 1)	HGNC	EggNOG, Ensembl, HomoloGene, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Xcl1 (chemokine (C motif) ligand 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Xcl1 (X-C motif chemokine ligand 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100978961 (lymphotactin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	LOC490356 (lymphotactin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	LOC101970885 (lymphotactin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	XCL1 (chemokine (C motif) ligand 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	XCL2 (X-C motif chemokine ligand 2)	HGNC	EggNOG, Ensembl, Inparanoid, OrthoDB, Panther, Treefam
Alliance orthologs ³
Mus musculus (house mouse):	Xcl1 (chemokine (C motif) ligand 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	XCL1 (X-C motif chemokine ligand 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	XCL2 (X-C motif chemokine ligand 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	XCL2 (X-C motif chemokine ligand 2)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cxcl32b.1 (chemokine (C-X-C motif) ligand 32b, duplicate 1)	Alliance	DIOPT (InParanoid\|OrthoInspector)
Xenopus tropicalis (tropical clawed frog):	LOC100493953	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	79,781,784 - 79,785,440 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	79,781,784 - 79,785,440 (-)	Ensembl				GRCr8
mRatBN7.2	13	77,248,687 - 77,252,343 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	77,248,717 - 77,252,329 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	79,865,290 - 79,868,746 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	81,169,308 - 81,172,764 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	78,411,156 - 78,414,618 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	83,199,402 - 83,202,845 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	83,199,264 - 83,202,864 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	88,079,753 - 88,083,196 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	80,691,195 - 80,694,638 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	76,965,267 - 76,968,710 (-)	NCBI		Celera
RGSC_v3.1	13	80,705,382 - 80,708,826 (-)	NCBI
Cytogenetic Map	13	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

anti-basement membrane glomerulonephritis (IEP)

severe acute respiratory syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trimethylbenzene (EXP)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (EXP,ISO)

1-fluoro-2,4-dinitrobenzene (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,6-dinitrotoluene (EXP)

3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (EXP)

4,4'-diaminodiphenylmethane (ISO)

4-nitroquinoline N-oxide (ISO)

acetamide (EXP)

amitrole (EXP)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arsenite(3-) (ISO)

Azoxymethane (ISO)

benzalkonium chloride (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bortezomib (ISO)

Butylbenzyl phthalate (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

chloroquine (ISO)

choline (ISO)

cisplatin (ISO)

decabromodiphenyl ether (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

diepoxybutane (ISO)

diuron (ISO)

entinostat (ISO)

flavonoids (EXP,ISO)

furan (EXP)

glycidol (EXP)

microcystin-LR (ISO)

naphthalenes (EXP)

nickel atom (ISO)

nimesulide (ISO)

oxaliplatin (EXP)

panobinostat (ISO)

progesterone (ISO)

silicon dioxide (ISO)

tacrolimus hydrate (ISO)

testosterone (EXP)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

toluene 2,4-diisocyanate (ISO)

topotecan (EXP)

trichostatin A (ISO)

undecane (EXP)

valproic acid (EXP,ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

antimicrobial humoral immune response mediated by antimicrobial peptide (IBA,ISO)

cell chemotaxis (IBA)

cell-cell signaling (ISO)

cellular response to interleukin-4 (IEA,ISO)

cellular response to transforming growth factor beta stimulus (IEA,ISO)

chemokine-mediated signaling pathway (IBA)

chemotaxis (IEA,ISO)

immune response (IEA)

inflammatory response (IBA)

mature natural killer cell chemotaxis (IEA,ISO)

negative regulation of CD4-positive, alpha-beta T cell proliferation (ISO)

negative regulation of DNA-templated transcription (ISO)

negative regulation of interleukin-2 production (ISO)

negative regulation of T cell cytokine production (ISO)

negative regulation of T-helper 1 cell activation (ISO)

negative regulation of type II interferon production (ISO)

positive regulation of B cell chemotaxis (IEA,ISO)

positive regulation of CD4-positive, alpha-beta T cell proliferation (IEA,ISO)

positive regulation of CD8-positive, alpha-beta T cell proliferation (ISO)

positive regulation of cell migration (IBA)

positive regulation of granzyme A production (ISO)

positive regulation of granzyme B production (ISO)

positive regulation of immunoglobulin production in mucosal tissue (IEA,ISO)

positive regulation of interleukin-10 production (ISO)

positive regulation of leukocyte chemotaxis (IEA,ISO)

positive regulation of natural killer cell chemotaxis (IEA,ISO)

positive regulation of neutrophil chemotaxis (IEA,ISO)

positive regulation of release of sequestered calcium ion into cytosol (ISO)

positive regulation of T cell chemotaxis (IEA,ISO)

positive regulation of T cell cytokine production (IEA,ISO)

positive regulation of T cell mediated cytotoxicity (ISO)

positive regulation of T-helper 1 cell cytokine production (IEA,ISO)

positive regulation of T-helper 2 cell cytokine production (IEA,ISO)

positive regulation of thymocyte migration (IEA,ISO)

positive regulation of transcription by RNA polymerase II (ISO)

positive regulation of transforming growth factor beta production (ISO)

regulation of inflammatory response (ISO)

release of sequestered calcium ion into cytosol (ISO)

response to virus (ISO)

signal transduction (IEA)

Cellular Component

extracellular region (IEA)

extracellular space (IBA,IEA,ISO)

Molecular Function

CCR chemokine receptor binding (IBA)

chemokine activity (IBA,IEA,ISO)

chemokine receptor binding (IEA,ISO)

cytokine activity (IEA)

protein binding (ISO)

protein homodimerization activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

chemokine mediated signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Mechanisms of host defense following severe acute respiratory syndrome-coronavirus (SARS-CoV) pulmonary infection of mice.	Glass WG, etal., J Immunol. 2004 Sep 15;173(6):4030-9. doi: 10.4049/jimmunol.173.6.4030.
3.	Lymphotactin: a cytokine that represents a new class of chemokine.	Kelner GS, etal., Science 1994 Nov 25;266(5189):1395-9.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Expression of lymphotactin mRNA in experimental crescentic glomerulonephritis.	Natori Y, etal., Clin Exp Immunol. 1998 Aug;113(2):265-8.
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:7602097	PMID:8757601	PMID:9013979	PMID:9029087	PMID:9632725	PMID:9973465	PMID:10518929	PMID:10887101	PMID:11181058	PMID:11889129	PMID:12949249	PMID:14734774
PMID:18832695	PMID:24155383	PMID:29588250	PMID:31649144

Genomics

Comparative Map Data

Xcl1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	79,781,784 - 79,785,440 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	79,781,784 - 79,785,440 (-)	Ensembl				GRCr8
mRatBN7.2	13	77,248,687 - 77,252,343 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	77,248,717 - 77,252,329 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	79,865,290 - 79,868,746 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	81,169,308 - 81,172,764 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	78,411,156 - 78,414,618 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	83,199,402 - 83,202,845 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	83,199,264 - 83,202,864 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	88,079,753 - 88,083,196 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	80,691,195 - 80,694,638 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	76,965,267 - 76,968,710 (-)	NCBI		Celera
RGSC_v3.1	13	80,705,382 - 80,708,826 (-)	NCBI
Cytogenetic Map	13	q23	NCBI

XCL1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	168,576,605 - 168,582,069 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	168,576,605 - 168,582,069 (+)	Ensembl			hg38	GRCh38
GRCh37	1	168,545,843 - 168,551,307 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	166,812,480 - 166,817,939 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	165,277,513 - 165,282,973	NCBI
Celera	1	141,655,651 - 141,661,108 (+)	NCBI		Celera
Cytogenetic Map	1	q24.2	NCBI
HuRef	1	139,791,807 - 139,797,411 (+)	NCBI		HuRef
CHM1_1	1	169,967,701 - 169,973,305 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	167,929,278 - 167,937,161 (+)	NCBI		T2T-CHM13v2.0

Xcl1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	164,759,216 - 164,763,094 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	164,759,213 - 164,763,096 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	164,931,644 - 164,935,522 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	164,931,644 - 164,935,527 (-)	Ensembl			mm10	GRCm38
MGSCv37	1	166,861,779 - 166,865,641 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	166,768,323 - 166,772,185 (-)	NCBI		MGSCv36	mm8
Celera	1	167,368,241 - 167,372,103 (-)	NCBI		Celera
Cytogenetic Map	1	H2.2	NCBI
cM Map	1	72.26	NCBI

Xcl1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955462	8,594,326 - 8,598,221 (-)	Ensembl
ChiLan1.0	NW_004955462	8,594,416 - 8,598,101 (-)	NCBI	ChiLan1.0	ChiLan1.0

LOC100978961
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	81,183,655 - 81,414,929 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	80,852,442 - 81,083,586 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	143,837,578 - 144,068,261 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	147,563,331 - 147,790,587 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	147,785,654 - 147,790,587 (+)	Ensembl			panPan2	panpan1.1

LOC490356
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	29,986,433 - 29,991,096 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	29,518,512 - 29,708,129 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	29,804,708 - 29,995,081 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
UMICH_Zoey_3.1	7	29,637,969 - 29,827,991 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	29,673,524 - 29,863,628 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	29,911,837 - 30,102,031 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

LOC101970885
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	99,978,802 - 99,991,355 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936481	17,825,714 - 17,828,955 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

XCL1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	82,432,204 - 82,436,180 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	82,432,845 - 82,436,150 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	90,116,396 - 90,119,701 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

Variants

Variants in Xcl1
38 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	19
Count of miRNA genes:	15
Interacting mature miRNAs:	18
Transcripts:	ENSRNOT00000003976
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	48639634	93639634	Rat
10755495	Bp387	Blood pressure QTL 387	3.78		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	37216241	90057603	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	38975045	103588154	Rat
8655951	Rf63	Renal function QTL 63	12.2		blood urea nitrogen amount (VT:0005265)	plasma urea nitrogen level (CMO:0000586)	13	71610804	109350286	Rat
70220	Bp55	Blood pressure QTL 55	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	39924693	84924693	Rat
8655945	Rf61	Renal function QTL 61	3.6		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	13	71610804	89333251	Rat
71119	Thym2	Thymus enlargement QTL 2	3.8		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	13	48749814	87285480	Rat
4889861	Pur29	Proteinuria QTL 29	13.8	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	39968211	83286298	Rat
1331783	Bp221	Blood pressure QTL 221	3.72886		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	71610804	89333251	Rat
8655959	Pur32	Proteinuria QTL 32	8.4		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	72984506	99745408	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	67635937	109350286	Rat
1300166	Kidm6	Kidney mass QTL 6	3.93		kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	13	71610804	89333251	Rat
619615	Bp80	Blood pressure QTL 80		0.0354	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	7421791	87286911	Rat
61340	Bp25	Blood pressure QTL 25	4.2	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	37087983	82087983	Rat
1581573	Uae36	Urinary albumin excretion QTL 36			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
1549897	Stresp12	Stress response QTL 12	3.35		stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	13	40983585	85983585	Rat
724564	Uae11	Urinary albumin excretion QTL 11	5.7		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	13	47354258	94285672	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	21120177	109350286	Rat
738027	Lnnr6	Liver neoplastic nodule remodeling QTL 6	3.3		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	65613454	109350286	Rat
7387280	Uae43	Urinary albumin excretion QTL 43	5.69	0.4174	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	68983334	109350286	Rat
738026	Lnnr5	Liver neoplastic nodule remodeling QTL 5	3.29		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	62424592	88113509	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	67635937	109350286	Rat
61349	Bp31	Blood pressure QTL 31	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	39924693	84924693	Rat
1576318	Schws5	Schwannoma susceptibility QTL 5		0.0351	nervous system integrity trait (VT:0010566)	post-insult time to trigeminal nerve neurilemmoma formation (CMO:0002019)	13	64497900	109350286	Rat
2303563	Bw89	Body weight QTL 89	6		body mass (VT:0001259)	body weight (CMO:0000012)	13	34834947	79834947	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	11081740	103588154	Rat
1581554	Pur11	Proteinuria QTL 11			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
12879477	Bp401	Blood pressure QTL 401			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	39814726	84814726	Rat
1331750	Bp220	Blood pressure QTL 220	2.98		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	39968211	84968211	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	64375743	109350286	Rat
11530006	Niddm72	Non-insulin dependent diabetes mellitus QTL 72		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	38286298	83286298	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	103588154	Rat
2293341	Glom15	Glomerulus QTL 15	9.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	13	67635937	109350286	Rat

Markers in Region

AI236158

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	77,248,803 - 77,248,924 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	83,199,341 - 83,199,461	NCBI	Rnor6.0
Rnor_5.0	13	88,079,692 - 88,079,812	UniSTS	Rnor5.0
RGSC_v3.4	13	80,691,134 - 80,691,254	UniSTS	RGSC3.4
Celera	13	76,965,206 - 76,965,326	UniSTS
RH 3.4 Map	13	485.8	UniSTS
Cytogenetic Map	13	q23	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
14	10	54	87	90	90	59	86	59	6	317	159	2	69	77	84	31	3	3

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_134361	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473958	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U23377	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000003976 ⟹ ENSRNOP00000003976

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	79,781,784 - 79,785,440 (-)	Ensembl
mRatBN7.2 Ensembl	13	77,248,717 - 77,252,329 (-)	Ensembl
Rnor_6.0 Ensembl	13	83,199,264 - 83,202,864 (-)	Ensembl

RefSeq Acc Id:

NM_134361 ⟹ NP_599188

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	79,781,784 - 79,785,440 (-)	NCBI
mRatBN7.2	13	77,248,687 - 77,252,343 (-)	NCBI
Rnor_6.0	13	83,199,402 - 83,202,845 (-)	NCBI
Rnor_5.0	13	88,079,753 - 88,083,196 (-)	NCBI
RGSC_v3.4	13	80,691,195 - 80,694,638 (-)	RGD
Celera	13	76,965,267 - 76,968,710 (-)	RGD

Sequence:

show sequence

ATGAGACTTCTCCTCCTGACTTTCCTGGGAGTCTGCTGCTTCGCCGCATGGGTTGTGGAAGGTG
TGGGCACTGAAGTCCTACAAGAGAGTATCTGTGTGAGCTTAAGAACCCAGCGGCTGCCAGTTCA
AAAAATCAAGACCTACACCATCAAGGAGGGAGCCATGAGAGCTGTAATTTTTGTCACCAAACGA
GGACTAAGAATTTGTGCTGATCCACAAGCCAAATGGGTGAAAACAGCCATCAAAACCGTAGATG
GCAGGGCCAGTGCCAGCAAGAGCAAGGCTGAAACTATTCCCACACAAGCCCAGAGGTCCGCCAG
CACAGCAGTAACCCTGACTGGGTAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_599188	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA69478	(Get FASTA)	NCBI Sequence Viewer
	EDM09342	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000003976
GenBank Protein	P51672	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_599188 ⟸ NM_134361
- Peptide Label:	precursor
- UniProtKB:	A0A4D6YKM5 (UniProtKB/TrEMBL), A0A4D6YMT2 (UniProtKB/TrEMBL), A0A4D6YMU3 (UniProtKB/TrEMBL), A0A4D6YMV4 (UniProtKB/TrEMBL), A0A4D6YNR9 (UniProtKB/TrEMBL), A0A4D6YW90 (UniProtKB/TrEMBL), G3V6D4 (UniProtKB/TrEMBL), A6IDF5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MRLLLLTFLGVCCFAAWVVEGVGTEVLQESICVSLRTQRLPVQKIKTYTIKEGAMRAVIFVTKR GLRICADPQAKWVKTAIKTVDGRASASKSKAETIPTQAQRSASTAVTLTG hide sequence

Ensembl Acc Id:

ENSRNOP00000003976 ⟸ ENSRNOT00000003976

Protein Domains

Chemokine interleukin-8-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P51672-F1-model_v2	AlphaFold	P51672	1-114	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620452	AgrOrtholog
BioCyc Gene	G2FUF-17583	BioCyc
Ensembl Genes	ENSRNOG00000002964	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000003976	ENTREZGENE
Gene3D-CATH	2.40.50.40	UniProtKB/Swiss-Prot
InterPro	Chemokine_b/g/d	UniProtKB/Swiss-Prot
	Chemokine_IL8-like_dom	UniProtKB/Swiss-Prot
	Chemokine_XCL1/XCL2	UniProtKB/Swiss-Prot
	Interleukin_8-like_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:171371	UniProtKB/Swiss-Prot
NCBI Gene	171371	ENTREZGENE
PANTHER	PTHR12015	UniProtKB/Swiss-Prot
	PTHR12015:SF101	UniProtKB/Swiss-Prot
Pfam	IL8	UniProtKB/Swiss-Prot
PhenoGen	Xcl1	PhenoGen
PRINTS	LYMPHOTACTIN	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000002964	RatGTEx
SMART	SCY	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF54117	UniProtKB/Swiss-Prot
UniProt	A0A4D6YKM5	ENTREZGENE, UniProtKB/TrEMBL
	A0A4D6YMT2	ENTREZGENE, UniProtKB/TrEMBL
	A0A4D6YMU3	ENTREZGENE, UniProtKB/TrEMBL
	A0A4D6YMV4	ENTREZGENE, UniProtKB/TrEMBL
	A0A4D6YNR9	ENTREZGENE, UniProtKB/TrEMBL
	A0A4D6YW90	ENTREZGENE, UniProtKB/TrEMBL
	A6IDF5	ENTREZGENE, UniProtKB/TrEMBL
	G3V6D4	ENTREZGENE, UniProtKB/TrEMBL
	P51672	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-08	Xcl1	X-C motif chemokine ligand 1	Xcl1	chemokine (C motif) ligand 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Xcl1	chemokine (C motif) ligand 1		small inducible cytokine subfamily C, member 1 (lymphotactin)	Name updated	1299863	APPROVED
2004-09-10	Xcl1	small inducible cytokine subfamily C, member 1 (lymphotactin)	Scyc1		Symbol and Name updated	1299863	APPROVED
2002-08-07	Scyc1	small inducible cytokine subfamily C, member 1 (lymphotactin)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)