Pigl (phosphatidylinositol glycan anchor biosynthesis, class L) - Rat Genome Database

Pigl (phosphatidylinositol glycan anchor biosynthesis, class L) - Rat Genome Database

Submit Data | Help | Video Tutorials | News | Publications | Download | REST API | Citing RGD | Contact

Advanced Search (OLGA)

Gene: Pigl (phosphatidylinositol glycan anchor biosynthesis, class L) Rattus norvegicus

Subscribe to Updates

Symbol:

Pigl

Name:

phosphatidylinositol glycan anchor biosynthesis, class L

RGD ID:

620437

Description:

Enables N-acetylglucosaminylphosphatidylinositol deacetylase activity. Involved in GPI anchor biosynthetic process. Located in endoplasmic reticulum membrane. Human ortholog(s) of this gene implicated in CHIME syndrome. Orthologous to human PIGL (phosphatidylinositol glycan anchor biosynthesis class L); PARTICIPATES IN glycosylphosphatidylinositol anchor biosynthetic pathway; INTERACTS WITH 17beta-estradiol; 4-amino-2,6-dinitrotoluene; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

Previously known as:

N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase; phosphatidylinositol glycan, class L; phosphatidylinositol-glycan biosynthesis class L protein; PIG-L

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Candidate Gene For:

Scl83

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	47,641,478 - 47,699,200 (+)	NCBI		GRCr8
mRatBN7.2	10	47,142,160 - 47,199,892 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	47,141,780 - 47,200,145 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	51,845,763 - 51,903,705 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	51,336,320 - 51,394,255 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	46,839,726 - 46,897,666 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	48,774,018 - 48,831,848 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	48,773,828 - 48,831,855 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	48,560,437 - 48,618,267 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	48,629,666 - 48,689,128 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	48,642,908 - 48,703,004 (+)	NCBI
Celera	10	46,389,721 - 46,447,273 (+)	NCBI		Celera
Cytogenetic Map	10	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pigl	Rat	CHIME syndrome		ISO	PIGL (Homo sapiens)	243048422	DNA:missense mutation:CDS:c.500T>C (p.L167P) (human)	RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pigl	Rat	CHIME syndrome		ISO	PIGL (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:11438011 more ...
Pigl	Rat	genetic disease		ISO	PIGL (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:18414213 more ...
Pigl	Rat	hyperphosphatasia with impaired intellectual development syndrome		ISO	PIGL (Homo sapiens)	8554872	ClinVar Annotator: match by term: MABRY SYNDROME	ClinVar
Pigl	Rat	hyperphosphatasia with impaired intellectual development syndrome 1		ISO	PIGL (Homo sapiens)	8554872	ClinVar Annotator: match by term: GLYCOSYLPHOSPHATIDYLINOSITOL BIOSYNTHESIS DEFECT 2	ClinVar
Pigl	Rat	Hypertelorism		ISO	PIGL (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hypertelorism	ClinVar	PMID:18414213 more ...
Pigl	Rat	Premature Birth		ISO	PIGL (Homo sapiens)	8554872	ClinVar Annotator: match by term: Premature birth	ClinVar	PMID:18414213 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pigl	Rat	CHIME syndrome		ISO	PIGL (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pigl	Rat	CHIME syndrome		ISO	PIGL (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pigl	Rat	1,2-dimethylhydrazine	affects expression	ISO	Pigl (Mus musculus)	6480464	1 and 2-Dimethylhydrazine affects the expression of PIGL mRNA	CTD	PMID:22206623
Pigl	Rat	17beta-estradiol	multiple interactions	EXP		6480464	[bisphenol A co-treated with Estradiol] results in increased expression of PIGL mRNA	CTD	PMID:26496021
Pigl	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Pigl (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of PIGL mRNA	CTD	PMID:21570461
Pigl	Rat	4-amino-2,6-dinitrotoluene	affects expression	EXP		6480464	4-amino-2 and 6-dinitrotoluene affects the expression of PIGL mRNA	CTD	PMID:21346803
Pigl	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	Pigl (Mus musculus)	6480464	Fenretinide results in increased expression of PIGL mRNA	CTD	PMID:28973697
Pigl	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of PIGL mRNA	CTD	PMID:30047161
Pigl	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of PIGL mRNA	CTD	PMID:30047161
Pigl	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of PIGL mRNA	CTD	PMID:16483693
Pigl	Rat	benzo[a]pyrene	increases expression	ISO	PIGL (Homo sapiens)	6480464	Benzo(a)pyrene results in increased expression of PIGL mRNA	CTD	PMID:21632981
Pigl	Rat	beta-lapachone	increases expression	ISO	PIGL (Homo sapiens)	6480464	beta-lapachone results in increased expression of PIGL mRNA	CTD	PMID:38218311
Pigl	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with Estradiol] results in increased expression of PIGL mRNA	CTD	PMID:26496021
Pigl	Rat	bisphenol A	multiple interactions	ISO	PIGL (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of PIGL gene	CTD	PMID:31601247
Pigl	Rat	bisphenol A	increases methylation	ISO	PIGL (Homo sapiens)	6480464	bisphenol A results in increased methylation of PIGL gene	CTD	PMID:31601247
Pigl	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of PIGL mRNA	CTD	PMID:30816183 more ...
Pigl	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of PIGL mRNA	CTD	PMID:25181051
Pigl	Rat	bisphenol A	decreases expression	ISO	Pigl (Mus musculus)	6480464	bisphenol A results in decreased expression of PIGL mRNA	CTD	PMID:26063408
Pigl	Rat	cadmium dichloride	decreases expression	ISO	PIGL (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of PIGL mRNA	CTD	PMID:38568856
Pigl	Rat	cyclosporin A	increases expression	ISO	PIGL (Homo sapiens)	6480464	Cyclosporine results in increased expression of PIGL mRNA	CTD	PMID:25562108
Pigl	Rat	Dibutyl phosphate	affects expression	ISO	PIGL (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of PIGL mRNA	CTD	PMID:37042841
Pigl	Rat	dorsomorphin	multiple interactions	ISO	PIGL (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PIGL mRNA	CTD	PMID:27188386
Pigl	Rat	epoxiconazole	decreases expression	ISO	Pigl (Mus musculus)	6480464	epoxiconazole results in decreased expression of PIGL mRNA	CTD	PMID:35436446
Pigl	Rat	fenthion	decreases expression	ISO	Pigl (Mus musculus)	6480464	Fenthion results in decreased expression of PIGL mRNA	CTD	PMID:34813904
Pigl	Rat	fulvestrant	multiple interactions	ISO	PIGL (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of PIGL gene	CTD	PMID:31601247
Pigl	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of PIGL mRNA	CTD	PMID:33387578
Pigl	Rat	ketamine	decreases expression	EXP		6480464	Ketamine results in decreased expression of PIGL mRNA	CTD	PMID:20080153
Pigl	Rat	mercaptoethanol	affects response to substance	ISO	Pigl (Mus musculus)	6480464	PIGL protein affects the susceptibility to Mercaptoethanol deficiency	CTD	PMID:25250048
Pigl	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of PIGL mRNA	CTD	PMID:30047161
Pigl	Rat	monocrotaline	decreases expression	ISO	Pigl (Mus musculus)	6480464	Monocrotaline results in decreased expression of PIGL mRNA	CTD	PMID:28818515
Pigl	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of PIGL mRNA	CTD	PMID:33387578
Pigl	Rat	paraquat	affects response to substance	ISO	Pigl (Mus musculus)	6480464	PIGL protein affects the susceptibility to Paraquat	CTD	PMID:25250048
Pigl	Rat	pentachlorophenol	decreases expression	ISO	Pigl (Mus musculus)	6480464	Pentachlorophenol results in decreased expression of PIGL mRNA	CTD	PMID:23892564
Pigl	Rat	pirinixic acid	increases expression	ISO	Pigl (Mus musculus)	6480464	pirinixic acid results in increased expression of PIGL mRNA	CTD	PMID:18301758
Pigl	Rat	pregnenolone 16alpha-carbonitrile	decreases expression	EXP		6480464	Pregnenolone Carbonitrile results in decreased expression of PIGL mRNA	CTD	PMID:30047161
Pigl	Rat	resveratrol	multiple interactions	ISO	PIGL (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in increased expression of PIGL mRNA	CTD	PMID:23557933
Pigl	Rat	SB 431542	multiple interactions	ISO	PIGL (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PIGL mRNA	CTD	PMID:27188386
Pigl	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of PIGL mRNA	CTD	PMID:30047161
Pigl	Rat	sunitinib	increases expression	ISO	PIGL (Homo sapiens)	6480464	Sunitinib results in increased expression of PIGL mRNA	CTD	PMID:31533062
Pigl	Rat	temozolomide	increases expression	ISO	PIGL (Homo sapiens)	6480464	Temozolomide results in increased expression of PIGL mRNA	CTD	PMID:31758290
Pigl	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of PIGL mRNA	CTD	PMID:34492290
Pigl	Rat	trichostatin A	decreases expression	ISO	PIGL (Homo sapiens)	6480464	trichostatin A results in decreased expression of PIGL mRNA	CTD	PMID:24935251 and PMID:26272509
Pigl	Rat	Triptolide	increases expression	ISO	Pigl (Mus musculus)	6480464	triptolide results in increased expression of PIGL mRNA	CTD	PMID:32835833
Pigl	Rat	triptonide	increases expression	ISO	Pigl (Mus musculus)	6480464	triptonide results in increased expression of PIGL mRNA	CTD	PMID:33045310
Pigl	Rat	troglitazone	increases expression	ISO	Pigl (Mus musculus)	6480464	troglitazone results in increased expression of PIGL mRNA	CTD	PMID:28973697
Pigl	Rat	troglitazone	decreases expression	ISO	Pigl (Mus musculus)	6480464	troglitazone results in decreased expression of PIGL mRNA	CTD	PMID:28973697
Pigl	Rat	valproic acid	decreases expression	ISO	PIGL (Homo sapiens)	6480464	Valproic Acid results in decreased expression of PIGL mRNA	CTD	PMID:26272509
Pigl	Rat	valproic acid	multiple interactions	ISO	PIGL (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PIGL mRNA	CTD	PMID:27188386
Pigl	Rat	vinclozolin	decreases expression	EXP		6480464	vinclozolin results in decreased expression of PIGL mRNA	CTD	PMID:23034163

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pigl	Rat	GPI anchor biosynthetic process		IDA		729509		RGD
Pigl	Rat	GPI anchor biosynthetic process	involved_in	IEA	UniProtKB:Q9Y2B2 and ensembl:ENSP00000225609	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pigl	Rat	GPI anchor biosynthetic process	involved_in	IEA	UniProtKB-KW:KW-0337	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pigl	Rat	GPI anchor biosynthetic process	involved_in	IDA		401901217	PMID:10085243	UniProt
Pigl	Rat	GPI anchor biosynthetic process	involved_in	IEA	UniPathway:UPA00196	1600115	GO_REF:0000041	UniProt	GO_REF:0000041
Pigl	Rat	GPI anchor biosynthetic process	involved_in	ISO	PIGL (Homo sapiens)	1624291	PMID:10085243	RGD	PMID:10085243
Pigl	Rat	lipid metabolic process	involved_in	IEA	UniProtKB-KW:KW-0443	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pigl	Rat	endoplasmic reticulum	is_active_in	IBA	PANTHER:PTN000313006 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pigl	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB-KW:KW-0256	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pigl	Rat	endoplasmic reticulum membrane	located_in	IDA		729509	PMID:9188481	UniProt
Pigl	Rat	endoplasmic reticulum membrane	located_in	IEA	UniProtKB-SubCell:SL-0097	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Pigl	Rat	endoplasmic reticulum membrane	located_in	IEA	UniProtKB:Q9Y2B2 and ensembl:ENSP00000225609	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pigl	Rat	endoplasmic reticulum membrane	located_in	ISO	PIGL (Homo sapiens)	1624291	PMID:14742432	RGD	PMID:14742432
Pigl	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pigl	Rat	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pigl	Rat	molecular_function		ND		1598407	03/2023: no relevant rat data	RGD
Pigl	Rat	N-acetylglucosaminylphosphatidylinositol deacetylase activity	enables	IBA	PANTHER:PTN000313006 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pigl	Rat	N-acetylglucosaminylphosphatidylinositol deacetylase activity	enables	IEA	EC:3.5.1.89	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Pigl	Rat	N-acetylglucosaminylphosphatidylinositol deacetylase activity	enables	IEA	RHEA:11660	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Pigl	Rat	N-acetylglucosaminylphosphatidylinositol deacetylase activity	enables	IDA		401901217	PMID:10085243	UniProt

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pigl	Rat	glycosylphosphatidylinositol anchor biosynthetic pathway		IEA		6907045		KEGG	rno:00563

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Expression cloning of PIG-L, a candidate N-acetylglucosaminyl-phosphatidylinositol deacetylase.	Nakamura N, etal., J Biol Chem 1997 Jun 20;272(25):15834-40.
3.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.	Mutations in the glycosylphosphatidylinositol gene PIGL cause CHIME syndrome.	Ng BG, etal., Am J Hum Genet. 2012 Apr 6;90(4):685-8. doi: 10.1016/j.ajhg.2012.02.010. Epub 2012 Mar 22.
5.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Comprehensive gene review and curation	RGD comprehensive gene curation
11.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
12.	Mammalian PIG-L and its yeast homologue Gpi12p are N-acetylglucosaminylphosphatidylinositol de-N-acetylases essential in glycosylphosphatidylinositol biosynthesis.	Watanabe R, etal., Biochem J. 1999 Apr 1;339 ( Pt 1)(Pt 1):185-92.

PMID:15489334	PMID:15817455

Pigl
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	47,641,478 - 47,699,200 (+)	NCBI		GRCr8
mRatBN7.2	10	47,142,160 - 47,199,892 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	47,141,780 - 47,200,145 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	51,845,763 - 51,903,705 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	51,336,320 - 51,394,255 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	46,839,726 - 46,897,666 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	48,774,018 - 48,831,848 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	48,773,828 - 48,831,855 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	48,560,437 - 48,618,267 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	48,629,666 - 48,689,128 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	48,642,908 - 48,703,004 (+)	NCBI
Celera	10	46,389,721 - 46,447,273 (+)	NCBI		Celera
Cytogenetic Map	10	q23	NCBI

PIGL
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	16,217,210 - 16,326,411 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	16,217,191 - 16,351,797 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	16,120,524 - 16,229,725 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	16,061,234 - 16,170,298 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	16,061,260 - 16,170,296	NCBI
Celera	17	16,023,433 - 16,132,500 (+)	NCBI		Celera
Cytogenetic Map	17	p11.2	NCBI
HuRef	17	15,987,546 - 16,096,166 (+)	NCBI		HuRef
CHM1_1	17	16,130,315 - 16,239,332 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	16,119,521 - 16,254,125 (+)	NCBI		T2T-CHM13v2.0

Pigl
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	62,349,267 - 62,406,863 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	62,349,286 - 62,405,243 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	62,458,441 - 62,516,037 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	62,458,460 - 62,514,417 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	62,271,962 - 62,327,402 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	62,274,655 - 62,330,095 (+)	NCBI		MGSCv36	mm8
Celera	11	69,377,657 - 69,433,527 (+)	NCBI		Celera
Cytogenetic Map	11	B2	NCBI
cM Map	11	38.34	NCBI

Pigl
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955467	1,566,494 - 1,645,158 (+)	NCBI	ChiLan1.0	ChiLan1.0

PIGL
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	56,283,682 - 56,417,860 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	61,097,246 - 61,229,497 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	35,122,347 - 35,252,800 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	110,417,772 - 110,523,985 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	110,417,770 - 110,546,387 (+)	Ensembl	panpan1.1		panPan2

PIGL
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	39,601,288 - 39,687,125 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	39,601,291 - 39,686,908 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	39,747,720 - 39,833,502 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	39,711,630 - 39,797,577 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	39,711,924 - 39,797,068 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	39,683,300 - 39,769,219 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	39,628,568 - 39,714,511 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	39,820,769 - 39,906,365 (-)	NCBI		UU_Cfam_GSD_1.0

Pigl
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	59,431,040 - 59,523,768 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936821	288,026 - 381,172 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936821	290,240 - 381,126 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PIGL
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	59,201,556 - 59,256,829 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	59,217,267 - 59,256,896 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	62,342,368 - 62,382,439 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PIGL
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	15,340,548 - 15,351,677 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666059	5,518,598 - 5,629,387 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pigl
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624877	4,117,075 - 4,202,616 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624877	4,078,752 - 4,202,024 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

.

Variants in Pigl
232 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	104
Count of miRNA genes:	77
Interacting mature miRNAs:	94
Transcripts:	ENSRNOT00000004113
Prediction methods:	Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35392457	63642539	Rat
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
152025229	Scl83	Serum cholesterol level QTL 83	4.33		blood cholesterol amount (VT:0000180)		10	35710580	68663659	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
152025227	Bw195	Body weight QTL 195	5.73		body mass (VT:0001259)		10	46989699	68663659	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	41142633	86142633	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6375746	51375746	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41333258	86333258	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44441699	89441699	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45029650	95600334	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21329805	61345413	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35392267	64155584	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29299504	64155584	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42323132	87323132	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44441699	89441699	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42323132	87323132	Rat
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5387014	50387014	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5387014	50387014	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
2317043	Aia7	Adjuvant induced arthritis QTL 7	3.82		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	37565079	82565079	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	26521957	61345413	Rat
2317042	Aia20	Adjuvant induced arthritis QTL 20	3.38		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	37565079	82565079	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5387014	50387014	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
1354614	Hpcl1	Hepatic cholesterol level QTL 1	3.3		liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	35392267	51793994	Rat
631532	Cm50	Cardiac mass QTL 50	6.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	17907113	51786432	Rat
1576319	Cia29	Collagen induced arthritis QTL 29			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	33973921	78973921	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	41944526	78307017	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1600371	Mcs21	Mammary carcinoma susceptibility QTL 21	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	28875650	52200160	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44441699	89441699	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	42876766	79813922	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat

D10Got75

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	47,158,722 - 47,158,915 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	48,790,765 - 48,790,957	NCBI	Rnor6.0
Rnor_5.0	10	48,577,184 - 48,577,376	UniSTS	Rnor5.0
RGSC_v3.4	10	48,646,630 - 48,646,823	RGD	RGSC3.4
RGSC_v3.4	10	48,646,631 - 48,646,823	UniSTS	RGSC3.4
RGSC_v3.1	10	48,660,254 - 48,660,446	RGD
Celera	10	46,406,248 - 46,406,432	UniSTS
RH 3.4 Map	10	543.1	UniSTS
RH 3.4 Map	10	543.1	RGD
RH 2.0 Map	10	542.8	RGD
Cytogenetic Map	10	q23	UniSTS

RH133086

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	47,148,633 - 47,148,830 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	48,780,492 - 48,780,688	NCBI	Rnor6.0
Rnor_5.0	10	48,566,911 - 48,567,107	UniSTS	Rnor5.0
RGSC_v3.4	10	48,636,140 - 48,636,336	UniSTS	RGSC3.4
Celera	10	46,396,195 - 46,396,391	UniSTS
RH 3.4 Map	10	543.2	UniSTS
Cytogenetic Map	10	q23	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_138901	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008767767	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC074020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D88364	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000004113 ⟹ ENSRNOP00000004113

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	47,141,780 - 47,200,145 (+)	Ensembl
Rnor_6.0 Ensembl	10	48,773,828 - 48,831,855 (+)	Ensembl

RefSeq Acc Id:

NM_138901 ⟹ NP_620256

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	47,641,478 - 47,699,200 (+)	NCBI
mRatBN7.2	10	47,142,160 - 47,199,892 (+)	NCBI
Rnor_6.0	10	48,774,018 - 48,831,848 (+)	NCBI
Rnor_5.0	10	48,560,437 - 48,618,267 (+)	NCBI
RGSC_v3.4	10	48,629,666 - 48,689,128 (+)	RGD
Celera	10	46,389,721 - 46,447,273 (+)	RGD

Sequence:

show sequence

TTACCCGGCATGGAAGTGGTGGGTCTCTTGTGTGTGGCCGTGGCTGTCCTGACTTGGGGCTTCCTCCGGGTTTGGAACTCAGCGGAACGAATGAGGTCTCCGGAGCAGGCGGGCCTACCGGGAGCCGG
AAGCCGGGCCCTTGTAGTGATCGCGCACCCGGACGATGAAGCCATGTTCTTTGCTCCCACGATACTAGGCTTGGCACGCCTGAAGCAGCAGGTGTCCCTGCTCTGCTTCTCCTCAGGAAATTACTACA
ATCAAGGTGAGATTCGAAAGAAAGAACTTCTGCAGAGCTGTGCTGTCTTGGGGATTCCACCTTCCCGTGTAATGATTATTGACAAGAGGGAGTTTCCAGATGATCCAGAAGTGCAGTGGGACACAGAG
CATGTGGCCAGCACCATCCTCCAGCACATACATGCCAATGCCACCGACTTGGTGGTGACTTTTGATGCAGAAGGAGTCAGTGGTCACAGCAACCATATTGCCTTGTACAAAGCTGTGAGGGCCCTGCA
CTCAGGAGGGAAGCTGCCTGAAGGGTGCTCTGTACTTACTCTCCAGTCTGTGAACGTGCTTCGGAAGTATGTCTTCCTCCTGGATCTCCCCTGGACTCTACTGTCGCCCCAGGGTGTTCTCTTTGTGC
TCACCAGCAAAGAAGTGGCACAGGCCAAGAAAGCCATGTCCTGCCACCGCAGTCAGCTGCTCTGGTTCCGCCACCTCTACACCGTCTTCTCGAGATACATGAGCGTCAACTCGCTGCAGTTGCTCTGA
GGCCTGAGAGCTGTCAGCTCCTCGGAGCAGGGGAGCAGCAGAGCAGGAAGTCCCCTGGCCAGACCTGGGCTGACTGACCTGCTTGACCAGGGAGACCCCAGCAAAGCAGCCTCCGCCTAACAGGAACC
ACATGGACAATGGGTCACCCCAACCCAGAAGGCTGCAAGTCCAGAACCAAGTTATATTGGGGTGTCCTTAGGTAAACACTTGAGAATATAGAAGCAGCTCCCTAGTTCCCAACAACCAAAAGGCTAAG
GAGTCTTTCAGATAGCACCTGAGGCCTACAGCTGAGACTCCTGGCTTTCCTGTGATCTGCCTACCTGATGTTCCCACTGTGTGCACGAGAAATGCCCGTGTGTGACTTCAGTTGTCCTGCTGCTACAA
AACCTCGTGGAACTGAGGTTTACACATTGGAACATGAAACTGGGTAACCTGAATGTGTGTCCTGGGCACTGTCACATACTTCACTCCAGGATAAACTACCTCACATCCTCTTTGAAGTGAGGACTGTT
ACTTTGTTGACAGTATCCTTTGAGTTTTTTATGATATACACAACAGTACAACCTATGAAAAATGTTTTCAAATCCTAGACGTTAAAAAGATGCATAGACTTACAATGAAAAAAAAAAAAAAAAAAAAA
AA

hide sequence


Protein RefSeqs	NP_620256	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH74020	(Get FASTA)	NCBI Sequence Viewer
	BAA20869	(Get FASTA)	NCBI Sequence Viewer
	EDM04707	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000004113
	ENSRNOP00000004113.3
GenBank Protein	O35790	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_620256 ⟸ NM_138901

- UniProtKB:

O35790 (UniProtKB/Swiss-Prot), A6HFA2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEVVGLLCVAVAVLTWGFLRVWNSAERMRSPEQAGLPGAGSRALVVIAHPDDEAMFFAPTILGLARLKQQVSLLCFSSGNYYNQGEIRKKELLQSCAVLGIPPSRVMIIDKREFPDDPEVQWDTEHVA
STILQHIHANATDLVVTFDAEGVSGHSNHIALYKAVRALHSGGKLPEGCSVLTLQSVNVLRKYVFLLDLPWTLLSPQGVLFVLTSKEVAQAKKAMSCHRSQLLWFRHLYTVFSRYMSVNSLQLL

hide sequence

Ensembl Acc Id:

ENSRNOP00000004113 ⟸ ENSRNOT00000004113

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O35790-F1-model_v2	AlphaFold	O35790	1-252	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

Promoter ID:

Type:

multiple initiation site

Name:

Pigl_1

Description:

phosphatidylinositol glycan anchor biosynthesis, class L

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	48,774,010 - 48,774,070	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-24775	BioCyc
Ensembl Genes	ENSRNOG00000003070	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000004113	ENTREZGENE
	ENSRNOT00000004113.5	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.10320	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7104008	IMAGE-MGC_LOAD
InterPro	GlcNAc_PI_deacetylase-related	UniProtKB/Swiss-Prot
	LmbE-like_dom_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:192263	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:91484	IMAGE-MGC_LOAD
NCBI Gene	192263	ENTREZGENE
PANTHER	PTHR12993	UniProtKB/Swiss-Prot
	PTHR12993:SF11	UniProtKB/Swiss-Prot
Pfam	PIG-L	UniProtKB/Swiss-Prot
PhenoGen	Pigl	PhenoGen
RatGTEx	ENSRNOG00000003070	RatGTEx
Superfamily-SCOP	SSF102588	UniProtKB/Swiss-Prot
UniProt	A6HFA2	ENTREZGENE, UniProtKB/TrEMBL
	O35790	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-25	Pigl	phosphatidylinositol glycan anchor biosynthesis, class L	Pigl	phosphatidylinositol glycan, class L	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Pigl	phosphatidylinositol glycan, class L			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Pigl	phosphatidylinositol glycan, class L			Symbol and Name status set to provisional	70820	PROVISIONAL