Symbol:
Phkb
Name:
phosphorylase kinase regulatory subunit beta
RGD ID:
620186
Description:
Predicted to enable calmodulin binding activity. Involved in protein phosphorylation. Part of phosphorylase kinase complex. Human ortholog(s) of this gene implicated in glycogen storage disease IXb. Orthologous to human PHKB (phosphorylase kinase regulatory subunit beta); PARTICIPATES IN glycogen degradation pathway; calcium/calcium-mediated signaling pathway; insulin signaling pathway; INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC361377; phosphorylase b kinase regulatory subunit beta; phosphorylase kinase beta subunit; phosphorylase kinase, beta; similar to phosphorylase kinase (EC 2.7.1.38) beta chain, non-muscle - rabbit
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 37,179,937 - 37,383,979 (-) NCBI GRCr8 mRatBN7.2 19 21,013,719 - 21,210,671 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 21,025,733 - 21,210,633 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 22,713,124 - 22,893,420 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 27,907,652 - 28,087,942 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 30,870,462 - 31,050,747 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 22,031,684 - 22,281,788 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 22,033,228 - 22,281,778 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 33,031,043 - 33,289,256 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 22,373,355 - 22,561,509 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 22,378,643 - 22,380,741 (-) NCBI Celera 19 20,893,425 - 21,075,361 (-) NCBI Celera Cytogenetic Map 19 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Phkb Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of PHKB mRNA] CTD PMID:31150632 Phkb Rat (1->4)-beta-D-glucan multiple interactions ISO Phkb (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PHKB mRNA CTD PMID:36331819 Phkb Rat 1,2-dichloroethane decreases expression ISO Phkb (Mus musculus) 6480464 ethylene dichloride results in decreased expression of PHKB mRNA CTD PMID:28960355 Phkb Rat 1,2-dimethylhydrazine decreases expression ISO Phkb (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of PHKB mRNA CTD PMID:22206623 Phkb Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of PHKB mRNA CTD PMID:30723492 Phkb Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of PHKB mRNA CTD PMID:26496021 Phkb Rat 17beta-estradiol decreases expression ISO Phkb (Mus musculus) 6480464 Estradiol results in decreased expression of PHKB mRNA CTD PMID:39298647 Phkb Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of PHKB mRNA CTD PMID:32145629 Phkb Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Phkb (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to PHKB promoter] CTD PMID:19654925 Phkb Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Phkb (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PHKB mRNA CTD PMID:21570461 and PMID:24680724 Phkb Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Phkb (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PHKB mRNA CTD PMID:19465110 and PMID:21354282 Phkb Rat 4,4'-sulfonyldiphenol increases expression ISO PHKB (Homo sapiens) 6480464 bisphenol S results in increased expression of PHKB mRNA CTD PMID:31121516 Phkb Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PHKB mRNA CTD PMID:30047161 Phkb Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of PHKB mRNA CTD PMID:31881176 Phkb Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of PHKB mRNA CTD PMID:28959563 Phkb Rat aflatoxin B1 decreases methylation ISO PHKB (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PHKB gene CTD PMID:27153756 Phkb Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PHKB mRNA CTD PMID:35163327 Phkb Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of PHKB mRNA CTD PMID:30047161 Phkb Rat antimycin A decreases expression ISO PHKB (Homo sapiens) 6480464 Antimycin A results in decreased expression of PHKB mRNA CTD PMID:33512557 Phkb Rat antirheumatic drug increases expression ISO PHKB (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of PHKB mRNA CTD PMID:24449571 Phkb Rat aristolochic acid A decreases expression ISO PHKB (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of PHKB mRNA CTD PMID:33212167 Phkb Rat arsenite(3-) decreases expression ISO Phkb (Mus musculus) 6480464 arsenite results in decreased expression of PHKB mRNA and arsenite results in decreased expression of PHKB protein CTD PMID:33053406 and PMID:37955338 Phkb Rat arsenite(3-) multiple interactions ISO PHKB (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to PHKB mRNA] CTD PMID:32406909 Phkb Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of PHKB gene CTD PMID:35440735 Phkb Rat Azoxymethane multiple interactions ISO Phkb (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PHKB mRNA CTD PMID:29950665 Phkb Rat benzo[a]pyrene affects methylation ISO PHKB (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PHKB intron CTD PMID:30157460 Phkb Rat benzo[b]fluoranthene increases expression ISO Phkb (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of PHKB mRNA CTD PMID:26377693 Phkb Rat bis(2-ethylhexyl) phthalate increases expression ISO Phkb (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of PHKB mRNA CTD PMID:34319233 Phkb Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of PHKB mRNA CTD PMID:26496021 Phkb Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PHKB mRNA CTD PMID:32145629 Phkb Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PHKB mRNA CTD PMID:30816183 and PMID:34947998 Phkb Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PHKB mRNA CTD PMID:25181051 Phkb Rat bisphenol F increases expression ISO PHKB (Homo sapiens) 6480464 bisphenol F results in increased expression of PHKB mRNA CTD PMID:31121516 Phkb Rat bortezomib increases expression ISO PHKB (Homo sapiens) 6480464 Bortezomib results in increased expression of PHKB mRNA CTD PMID:20977926 Phkb Rat butanal decreases expression ISO PHKB (Homo sapiens) 6480464 butyraldehyde results in decreased expression of PHKB mRNA CTD PMID:26079696 Phkb Rat cadmium atom multiple interactions ISO PHKB (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PHKB mRNA CTD PMID:35301059 Phkb Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of PHKB mRNA CTD PMID:33453195 Phkb Rat cadmium dichloride multiple interactions ISO PHKB (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PHKB mRNA CTD PMID:35301059 Phkb Rat caffeine decreases phosphorylation ISO PHKB (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of PHKB protein CTD PMID:35688186 Phkb Rat CGP 52608 multiple interactions ISO PHKB (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PHKB gene] CTD PMID:28238834 Phkb Rat cisplatin multiple interactions ISO Phkb (Mus musculus) 6480464 [Cisplatin co-treated with RELB mutant form co-treated with TNF protein] results in decreased expression of PHKB mRNA CTD PMID:23625948 Phkb Rat copper(II) sulfate decreases expression ISO PHKB (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of PHKB mRNA CTD PMID:19549813 Phkb Rat crocidolite asbestos decreases expression ISO Phkb (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of PHKB mRNA CTD PMID:29279043 Phkb Rat cyclosporin A increases expression ISO PHKB (Homo sapiens) 6480464 Cyclosporine results in increased expression of PHKB mRNA CTD PMID:27989131 Phkb Rat dextran sulfate multiple interactions ISO Phkb (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PHKB mRNA CTD PMID:29950665 Phkb Rat dioxygen multiple interactions ISO Phkb (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of PHKB mRNA CTD PMID:30529165 Phkb Rat doxorubicin decreases expression ISO PHKB (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PHKB mRNA CTD PMID:29803840 Phkb Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of PHKB mRNA CTD PMID:29391264 Phkb Rat formaldehyde decreases expression ISO PHKB (Homo sapiens) 6480464 Formaldehyde results in decreased expression of PHKB mRNA CTD PMID:23649840 Phkb Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of PHKB mRNA CTD PMID:22061828 Phkb Rat inulin multiple interactions ISO Phkb (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of PHKB mRNA CTD PMID:36331819 Phkb Rat ivermectin decreases expression ISO PHKB (Homo sapiens) 6480464 Ivermectin results in decreased expression of PHKB protein CTD PMID:32959892 Phkb Rat lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of PHKB mRNA and lead acetate results in increased expression of PHKB protein CTD PMID:28916327 Phkb Rat lead(0) affects expression ISO PHKB (Homo sapiens) 6480464 Lead affects the expression of PHKB mRNA CTD PMID:28903495 Phkb Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of PHKB mRNA CTD PMID:30047161 Phkb Rat methotrexate affects expression ISO Phkb (Mus musculus) 6480464 Methotrexate affects the expression of PHKB mRNA CTD PMID:18502557 Phkb Rat methylmercury chloride decreases expression ISO PHKB (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of PHKB mRNA CTD PMID:28001369 Phkb Rat monosodium L-glutamate multiple interactions ISO Phkb (Mus musculus) 6480464 [Sodium Glutamate co-treated with Trans Fatty Acids] results in increased expression of PHKB mRNA CTD PMID:19001666 Phkb Rat N-Acetyl-S-(1,2-dichlorovinyl)-cysteine affects expression ISO PHKB (Homo sapiens) 6480464 S-1 and 2-dichlorovinyl-N-acetylcysteine affects the expression of PHKB mRNA CTD PMID:16844155 Phkb Rat nickel atom decreases expression ISO PHKB (Homo sapiens) 6480464 Nickel results in decreased expression of PHKB mRNA CTD PMID:25583101 Phkb Rat ozone increases expression EXP 6480464 Ozone results in increased expression of PHKB protein CTD PMID:33146391 Phkb Rat ozone multiple interactions ISO Phkb (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of PHKB mRNA CTD PMID:27106289 Phkb Rat paracetamol affects expression ISO Phkb (Mus musculus) 6480464 Acetaminophen affects the expression of PHKB mRNA CTD PMID:17562736 Phkb Rat paracetamol decreases expression ISO PHKB (Homo sapiens) 6480464 Acetaminophen results in decreased expression of PHKB mRNA CTD PMID:21420995 and PMID:29067470 Phkb Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Phkb (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PHKB mRNA more ... CTD PMID:36331819 Phkb Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PHKB mRNA CTD PMID:35163327 Phkb Rat phenobarbital affects expression ISO PHKB (Homo sapiens) 6480464 Phenobarbital affects the expression of PHKB mRNA CTD PMID:19159669 Phkb Rat picoxystrobin decreases expression ISO PHKB (Homo sapiens) 6480464 picoxystrobin results in decreased expression of PHKB mRNA CTD PMID:33512557 Phkb Rat pirinixic acid decreases expression ISO Phkb (Mus musculus) 6480464 pirinixic acid results in decreased expression of PHKB mRNA CTD PMID:18445702 Phkb Rat potassium chromate decreases expression ISO PHKB (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of PHKB mRNA CTD PMID:22714537 Phkb Rat quercetin decreases expression ISO PHKB (Homo sapiens) 6480464 Quercetin results in decreased expression of PHKB mRNA CTD PMID:21632981 Phkb Rat rotenone decreases expression ISO PHKB (Homo sapiens) 6480464 Rotenone results in decreased expression of PHKB mRNA CTD PMID:33512557 Phkb Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of PHKB mRNA CTD PMID:30047161 Phkb Rat sunitinib decreases expression ISO PHKB (Homo sapiens) 6480464 Sunitinib results in decreased expression of PHKB mRNA CTD PMID:31533062 Phkb Rat tebufenpyrad decreases expression ISO PHKB (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of PHKB mRNA CTD PMID:33512557 Phkb Rat tert-butyl hydroperoxide decreases expression ISO PHKB (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of PHKB mRNA CTD PMID:15336504 Phkb Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of PHKB mRNA] CTD PMID:31150632 Phkb Rat tetrachloromethane decreases expression ISO Phkb (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of PHKB mRNA CTD PMID:31919559 Phkb Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of PHKB mRNA CTD PMID:31150632 Phkb Rat thimerosal decreases expression ISO PHKB (Homo sapiens) 6480464 Thimerosal results in decreased expression of PHKB mRNA CTD PMID:27188386 Phkb Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of PHKB mRNA CTD PMID:34492290 Phkb Rat titanium dioxide multiple interactions ISO Phkb (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PHKB mRNA CTD PMID:29950665 Phkb Rat titanium dioxide increases expression ISO Phkb (Mus musculus) 6480464 titanium dioxide results in increased expression of PHKB mRNA CTD PMID:35295148 Phkb Rat triphenyl phosphate affects expression ISO PHKB (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PHKB mRNA CTD PMID:37042841 Phkb Rat troglitazone decreases expression ISO Phkb (Mus musculus) 6480464 troglitazone results in decreased expression of PHKB mRNA CTD PMID:28973697 Phkb Rat trovafloxacin decreases expression ISO Phkb (Mus musculus) 6480464 trovafloxacin results in decreased expression of PHKB mRNA CTD PMID:35537566 Phkb Rat tunicamycin increases expression ISO Phkb (Mus musculus) 6480464 Tunicamycin results in increased expression of PHKB mRNA CTD PMID:17127020 Phkb Rat valproic acid affects expression ISO PHKB (Homo sapiens) 6480464 Valproic Acid affects the expression of PHKB mRNA CTD PMID:25979313 Phkb Rat valproic acid increases expression ISO PHKB (Homo sapiens) 6480464 Valproic Acid results in increased expression of PHKB mRNA CTD PMID:19101580 more ... Phkb Rat vorinostat affects expression ISO PHKB (Homo sapiens) 6480464 vorinostat affects the expression of PHKB mRNA CTD PMID:27188386
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (EXP) aflatoxin B1 (ISO) alpha-Zearalanol (EXP) amitrole (EXP) antimycin A (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) atrazine (EXP) Azoxymethane (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) bisphenol F (ISO) bortezomib (ISO) butanal (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) CGP 52608 (ISO) cisplatin (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) dextran sulfate (ISO) dioxygen (ISO) doxorubicin (ISO) endosulfan (EXP) formaldehyde (ISO) gentamycin (EXP) inulin (ISO) ivermectin (ISO) lead diacetate (EXP) lead(0) (ISO) methimazole (EXP) methotrexate (ISO) methylmercury chloride (ISO) monosodium L-glutamate (ISO) N-Acetyl-S-(1,2-dichlorovinyl)-cysteine (ISO) nickel atom (ISO) ozone (EXP,ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) picoxystrobin (ISO) pirinixic acid (ISO) potassium chromate (ISO) quercetin (ISO) rotenone (ISO) sulfadimethoxine (EXP) sunitinib (ISO) tebufenpyrad (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP,ISO) thimerosal (ISO) thioacetamide (EXP) titanium dioxide (ISO) triphenyl phosphate (ISO) troglitazone (ISO) trovafloxacin (ISO) tunicamycin (ISO) valproic acid (ISO) vorinostat (ISO)
1.
Phosphorylase kinase: the complexity of its regulation is reflected in the complexity of its structure.
Brushia RJ and Walsh DA, Front Biosci. 1999 Sep 15;4:D618-41.
2.
Coordinated expression of phosphorylase kinase subunits in regenerating skeletal muscle.
Cawley KC, etal., J Biol Chem 1992 Aug 25;267(24):17287-95.
3.
Purification of rat liver phosphorylase kinase.
Chrisman TD, etal., J Biol Chem. 1982 Sep 25;257(18):10798-804.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
The alpha and beta subunits of phosphorylase kinase are homologous: cDNA cloning and primary structure of the beta subunit.
Kilimann MW, etal., Proc Natl Acad Sci U S A 1988 Dec;85(24):9381-5.
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
8.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
9.
GOA pipeline
RGD automated data pipeline
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Rat skeletal muscle phosphorylase kinase: turnover and control of isozyme levels in culture.
Salsgiver WJ and Lawrence JC Jr, Am J Physiol. 1986 Mar;250(3 Pt 1):C365-73.
Phkb Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 37,179,937 - 37,383,979 (-) NCBI GRCr8 mRatBN7.2 19 21,013,719 - 21,210,671 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 21,025,733 - 21,210,633 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 22,713,124 - 22,893,420 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 27,907,652 - 28,087,942 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 30,870,462 - 31,050,747 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 22,031,684 - 22,281,788 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 22,033,228 - 22,281,778 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 33,031,043 - 33,289,256 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 22,373,355 - 22,561,509 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 22,378,643 - 22,380,741 (-) NCBI Celera 19 20,893,425 - 21,075,361 (-) NCBI Celera Cytogenetic Map 19 p11 NCBI
PHKB Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 47,461,299 - 47,701,523 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 47,461,123 - 47,701,523 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 47,495,210 - 47,735,434 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 46,052,739 - 46,291,755 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 46,052,738 - 46,291,755 NCBI Celera 16 32,003,151 - 32,243,373 (+) NCBI Celera Cytogenetic Map 16 q12.1 NCBI HuRef 16 33,385,772 - 33,625,996 (+) NCBI HuRef CHM1_1 16 48,902,240 - 49,142,934 (+) NCBI CHM1_1 T2T-CHM13v2.0 16 53,258,117 - 53,498,326 (+) NCBI T2T-CHM13v2.0
Phkb Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 86,567,489 - 86,790,883 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 86,567,588 - 86,788,005 (+) Ensembl GRCm39 Ensembl GRCm38 8 85,840,853 - 86,064,251 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 85,840,959 - 86,061,376 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 88,364,901 - 88,584,541 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 88,731,107 - 88,950,747 (+) NCBI MGSCv36 mm8 Celera 8 90,138,260 - 90,352,039 (+) NCBI Celera Cytogenetic Map 8 C3 NCBI cM Map 8 41.61 NCBI
Phkb Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955474 7,598,463 - 7,801,083 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955474 7,599,657 - 7,801,083 (-) NCBI ChiLan1.0 ChiLan1.0
PHKB Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 56,914,379 - 57,154,821 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 62,819,336 - 63,059,963 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 27,720,300 - 27,960,740 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 46,612,062 - 46,853,157 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 46,612,053 - 46,853,157 (+) Ensembl panpan1.1 panPan2
PHKB Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 67,260,532 - 67,476,596 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 67,254,542 - 67,476,532 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 63,836,201 - 64,052,047 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 67,818,656 - 68,034,694 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 67,818,659 - 68,034,650 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 64,631,779 - 64,847,974 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 65,655,460 - 65,871,221 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 66,543,573 - 66,759,826 (-) NCBI UU_Cfam_GSD_1.0
Phkb Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 58,586,224 - 58,809,915 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936475 779,302 - 1,003,262 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936475 779,238 - 1,002,851 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PHKB Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 36,991,274 - 37,193,593 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 36,994,424 - 37,193,631 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 32,141,368 - 32,246,744 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PHKB Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 33,288,396 - 33,512,445 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 33,291,009 - 33,513,244 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666047 43,031,736 - 43,259,030 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Phkb
.
Predicted Target Of
Count of predictions: 132 Count of miRNA genes: 105 Interacting mature miRNAs: 117 Transcripts: ENSRNOT00000049624 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1549847 Bss8 Bone structure and strength QTL 8 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 19 1 31963836 Rat 61447 Tcas1 Tongue tumor susceptibility QTL 1 6.08 tongue integrity trait (VT:0010553) squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875) 19 2316121 47316121 Rat 631681 Cm12 Cardiac mass QTL 12 3.33 0.00053 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 19 1 28982497 Rat 9590298 Uminl5 Urine mineral level QTL 5 3.59 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 19 1 36824771 Rat 1331737 Uae29 Urinary albumin excretion QTL 29 5.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 4096155 55283277 Rat 2298478 Eau8 Experimental allergic uveoretinitis QTL 8 0.0163 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 19 17154433 57337602 Rat 1578764 Stresp19 Stress response QTL 19 3.6 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 19 15630201 57337602 Rat 1558656 Prcs1 Prostate cancer susceptibility QTL 1 5 prostate integrity trait (VT:0010571) percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943) 19 15114598 34521833 Rat 9590090 Insglur8 Insulin/glucose ratio QTL 8 10.81 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 19 1 36824771 Rat 1331788 Rf45 Renal function QTL 45 2.818 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 19 15605023 46559041 Rat 724566 Uae12 Urinary albumin excretion QTL 12 5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 2187927 56457239 Rat 724565 Tcas5 Tongue tumor susceptibility QTL 5 10.04 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 19 9977753 39654489 Rat 61407 Scl12 Serum cholesterol level QTL 12 0.001 blood HDL cholesterol amount (VT:0000184) serum high density lipoprotein cholesterol level (CMO:0000361) 19 13926401 30303727 Rat 8552935 Pigfal10 Plasma insulin-like growth factor 1 level QTL 10 5.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 19 1 36824771 Rat 61350 Bp32 Blood pressure QTL 32 0.012 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 19 20483575 57337602 Rat 631840 Niddm38 Non-insulin dependent diabetes mellitus QTL 38 3.86 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 19 10323180 23069265 Rat 7411549 Bw130 Body weight QTL 130 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 15455860 57337602 Rat 10054132 Srcrt9 Stress Responsive Cort QTL 9 2.87 0.0017 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 27355345 Rat 724518 Uae19 Urinary albumin excretion QTL 19 5.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 7457249 42983518 Rat 8694186 Bw152 Body weight QTL 152 3.34 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 569374 45569374 Rat 61423 Cia14 Collagen induced arthritis QTL 14 3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 19 10827970 43544039 Rat 7411590 Foco7 Food consumption QTL 7 6.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 19 1 24688055 Rat 631678 Cm9 Cardiac mass QTL 9 4.27 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 19 1 28982497 Rat 9590250 Scort11 Serum corticosterone level QTL 11 23.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 36824771 Rat 2317848 Alcrsp21 Alcohol response QTL 21 1.899999976158142 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 19 3204777 48204777 Rat 9589102 Slep13 Serum leptin concentration QTL 13 4.63 0.001 blood leptin amount (VT:0005667) plasma leptin level (CMO:0000781) 19 569374 45569374 Rat 7247442 Uae39 Urinary albumin excretion QTL 39 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 2187927 46708701 Rat
RH144404
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 21,036,159 - 21,036,375 (+) MAPPER mRatBN7.2 Rnor_6.0 19 22,042,117 - 22,042,332 NCBI Rnor6.0 Rnor_5.0 19 33,053,642 - 33,053,857 UniSTS Rnor5.0 RGSC_v3.4 19 22,381,924 - 22,382,139 UniSTS RGSC3.4 Celera 19 20,901,792 - 20,902,007 UniSTS Cytogenetic Map 19 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000049624 ⟹ ENSRNOP00000039778
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 21,027,165 - 21,210,605 (-) Ensembl Rnor_6.0 Ensembl 19 22,033,730 - 22,281,778 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000086187 ⟹ ENSRNOP00000074948
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 21,027,165 - 21,210,633 (-) Ensembl Rnor_6.0 Ensembl 19 22,033,228 - 22,194,740 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000109870 ⟹ ENSRNOP00000076912
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 21,027,165 - 21,175,679 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000110468 ⟹ ENSRNOP00000083595
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 21,025,733 - 21,210,592 (-) Ensembl
RefSeq Acc Id:
NM_001014152 ⟹ NP_001014174
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 37,201,005 - 37,383,854 (-) NCBI mRatBN7.2 19 21,027,764 - 21,210,605 (-) NCBI Rnor_6.0 19 22,033,722 - 22,281,778 (-) NCBI Rnor_5.0 19 33,031,043 - 33,289,256 (-) NCBI RGSC_v3.4 19 22,373,355 - 22,561,509 (-) RGD Celera 19 20,893,425 - 21,075,361 (-) RGD
Sequence:
GTGGTGGGCACTGTGCAATGGCGGGGGAAGAGGGACTCATGTCTGAAGTAAGCTGGAAGCTCTTGGAACGACGAGCCCGGGCCAAGCGCTCAGGCTCAGTTTATGAACCTCTTAAAAGCATTAATCTT
hide sequence
RefSeq Acc Id:
NM_001414932 ⟹ NP_001401861
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 37,195,425 - 37,383,877 (-) NCBI mRatBN7.2 19 21,022,184 - 21,210,628 (-) NCBI
RefSeq Acc Id:
NM_001414933 ⟹ NP_001401862
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 37,195,425 - 37,383,877 (-) NCBI mRatBN7.2 19 21,022,184 - 21,210,628 (-) NCBI
RefSeq Acc Id:
NM_001414934 ⟹ NP_001401863
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 37,195,425 - 37,383,877 (-) NCBI mRatBN7.2 19 21,022,184 - 21,210,628 (-) NCBI
RefSeq Acc Id:
XM_063278110 ⟹ XP_063134180
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 37,200,993 - 37,383,885 (-) NCBI
RefSeq Acc Id:
XM_063278111 ⟹ XP_063134181
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 37,179,937 - 37,383,973 (-) NCBI
RefSeq Acc Id:
XM_063278112 ⟹ XP_063134182
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 37,228,815 - 37,383,978 (-) NCBI
RefSeq Acc Id:
XR_010060011
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 37,228,803 - 37,383,979 (-) NCBI
RefSeq Acc Id:
NP_001014174 ⟸ NM_001014152
- Peptide Label:
isoform 4
- UniProtKB:
A0A8I5Y5Q0 (UniProtKB/TrEMBL), F1LNP9 (UniProtKB/TrEMBL), Q5RKH5 (UniProtKB/TrEMBL)
- Sequence:
MAGEEGLMSEVSWKLLERRARAKRSGSVYEPLKSINLPRPDNETLWDKLDHYYRIVKSTMLTYQSPTTGLFPTKTCGGDQKSKVHESLYCAAGAWALALAYRRIDDDKGRTHELEHSAIKCMRGVLYC
hide sequence
Ensembl Acc Id:
ENSRNOP00000039778 ⟸ ENSRNOT00000049624
Ensembl Acc Id:
ENSRNOP00000074948 ⟸ ENSRNOT00000086187
Ensembl Acc Id:
ENSRNOP00000083595 ⟸ ENSRNOT00000110468
Ensembl Acc Id:
ENSRNOP00000076912 ⟸ ENSRNOT00000109870
RefSeq Acc Id:
NP_001401862 ⟸ NM_001414933
- Peptide Label:
isoform 2
- UniProtKB:
A0A8I5Y5Q0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001401861 ⟸ NM_001414932
- Peptide Label:
isoform 1
- UniProtKB:
A0A8J8YFM3 (UniProtKB/TrEMBL), A0A8I5Y5Q0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001401863 ⟸ NM_001414934
- Peptide Label:
isoform 3
- UniProtKB:
A6KDC6 (UniProtKB/TrEMBL), A0A0G2K9C8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134181 ⟸ XM_063278111
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I5Y5Q0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134180 ⟸ XM_063278110
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K9C8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134182 ⟸ XM_063278112
- Peptide Label:
isoform X3
RGD ID: 13700988 Promoter ID: EPDNEW_R11511 Type: initiation region Name: Phkb_1 Description: phosphorylase kinase regulatory subunit beta SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 19 22,281,769 - 22,281,829 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-05-20
Phkb
phosphorylase kinase regulatory subunit beta
Phkb
phosphorylase kinase beta subunit
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-04-27
Phkb
phosphorylase kinase beta subunit
Phkb
phosphorylase kinase, beta
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2009-01-20
Phkb
phosphorylase kinase, beta
Phkb
phosphorylase kinase beta
Data merged from RGD:1583833
737654 APPROVED
2007-09-11
Phkb
phosphorylase kinase beta
LOC361377
similar to phosphorylase kinase (EC 2.7.1.38) beta chain, non-muscle - rabbit
Symbol and Name updated to reflect Human and Mouse nomenclature
1299863 APPROVED
2006-11-19
LOC361377
similar to phosphorylase kinase (EC 2.7.1.38) beta chain, non-muscle - rabbit
Symbol and Name status set to provisional
70820 PROVISIONAL
2005-01-20
Phkb
phosphorylase kinase, beta
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Phkb
phosphorylase kinase, beta
Symbol and Name status set to provisional
70820 PROVISIONAL
