Symbol:
Spa17
Name:
sperm autoantigenic protein 17
RGD ID:
620154
Description:
Predicted to be involved in binding activity of sperm to zona pellucida. Predicted to be located in several cellular components, including external side of plasma membrane; neuron projection; and sperm flagellum. Orthologous to human SPA17 (sperm autoantigenic protein 17); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Sp17; sperm surface protein Sp17
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SPA17 (sperm autoantigenic protein 17) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Spa17 (sperm autoantigenic protein 17) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Spa17 (sperm autoantigenic protein 17) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SPA17 (sperm autoantigenic protein 17) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SPA17 (sperm autoantigenic protein 17) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Spa17 (sperm autoantigenic protein 17) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SPA17 (sperm autoantigenic protein 17) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LOC103215961 (sperm surface protein Sp17) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Spa17 (sperm autoantigenic protein 17) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Spa17 (sperm autoantigenic protein 17)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
SPA17 (sperm autoantigenic protein 17)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
spa17 (sperm autoantigenic protein 17)
Alliance
DIOPT (OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
F39H12.3
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER)
Drosophila melanogaster (fruit fly):
igl
Alliance
DIOPT (Ensembl Compara|PANTHER)
Xenopus tropicalis (tropical clawed frog):
spa17
Alliance
DIOPT (OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 45,496,175 - 45,507,262 (-) NCBI GRCr8 mRatBN7.2 8 37,307,432 - 37,318,519 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 37,307,557 - 37,318,639 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 41,324,053 - 41,332,966 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 39,607,116 - 39,616,029 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 37,469,996 - 37,478,909 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 40,066,954 - 40,078,131 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 40,067,076 - 40,078,165 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 40,067,778 - 40,078,956 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 38,843,007 - 38,852,080 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 38,851,772 - 38,860,846 (-) NCBI Celera 8 37,138,678 - 37,147,723 (+) NCBI Celera Cytogenetic Map 8 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Spa17 Rat 17alpha-ethynylestradiol affects expression ISO Spa17 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of SPA17 mRNA CTD PMID:17555576 Spa17 Rat 17alpha-ethynylestradiol multiple interactions ISO Spa17 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SPA17 mRNA CTD PMID:17942748 Spa17 Rat 17alpha-ethynylestradiol increases expression ISO Spa17 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of SPA17 mRNA CTD PMID:17942748 Spa17 Rat 17beta-estradiol decreases expression ISO Spa17 (Mus musculus) 6480464 Estradiol results in decreased expression of SPA17 mRNA CTD PMID:39298647 Spa17 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO SPA17 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of SPA17 mRNA CTD PMID:16631469 Spa17 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Spa17 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SPA17 mRNA CTD PMID:17942748 Spa17 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 AHR protein alternative form affects the reaction [Tetrachlorodibenzodioxin results in decreased expression of SPA17 mRNA] CTD PMID:21215274 Spa17 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SPA17 mRNA CTD PMID:21215274 Spa17 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Spa17 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of SPA17 mRNA CTD PMID:17942748 Spa17 Rat 2,3,7,8-Tetrachlorodibenzofuran increases expression EXP 6480464 2 more ... CTD PMID:32109520 Spa17 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of SPA17 mRNA CTD PMID:21346803 Spa17 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of SPA17 mRNA CTD PMID:21346803 Spa17 Rat 4,4'-sulfonyldiphenol increases expression ISO SPA17 (Homo sapiens) 6480464 bisphenol S results in increased expression of SPA17 mRNA CTD PMID:25912373 Spa17 Rat 4-hydroxynon-2-enal increases expression ISO Spa17 (Mus musculus) 6480464 4-hydroxy-2-nonenal results in increased expression of SPA17 mRNA CTD PMID:19191707 Spa17 Rat 4-hydroxyphenyl retinamide increases expression ISO Spa17 (Mus musculus) 6480464 Fenretinide results in increased expression of SPA17 mRNA CTD PMID:28973697 Spa17 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of SPA17 mRNA CTD PMID:25825206 Spa17 Rat aflatoxin B1 affects expression ISO SPA17 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of SPA17 protein CTD PMID:20106945 Spa17 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of SPA17 mRNA CTD PMID:33354967 Spa17 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SPA17 mRNA CTD PMID:16483693 Spa17 Rat antirheumatic drug decreases expression ISO SPA17 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of SPA17 mRNA CTD PMID:24449571 Spa17 Rat Aroclor 1254 increases expression ISO Spa17 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of SPA17 mRNA CTD PMID:23650126 Spa17 Rat arsane multiple interactions ISO SPA17 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SPA17 mRNA CTD PMID:39836092 Spa17 Rat arsenic atom multiple interactions ISO SPA17 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SPA17 mRNA CTD PMID:39836092 Spa17 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Spa17 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of SPA17 mRNA CTD PMID:33754040 Spa17 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SPA17 mRNA CTD PMID:25181051 more ... Spa17 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of SPA17 gene CTD PMID:28505145 Spa17 Rat bisphenol A increases expression ISO Spa17 (Mus musculus) 6480464 bisphenol A results in increased expression of SPA17 mRNA CTD PMID:27623287 Spa17 Rat bisphenol F decreases expression ISO Spa17 (Mus musculus) 6480464 bisphenol F results in decreased expression of SPA17 mRNA CTD PMID:38685157 Spa17 Rat carbon nanotube decreases expression ISO Spa17 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Spa17 Rat CGP 52608 multiple interactions ISO SPA17 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SPA17 gene] CTD PMID:28238834 Spa17 Rat chloroprene increases expression ISO Spa17 (Mus musculus) 6480464 Chloroprene results in increased expression of SPA17 mRNA CTD PMID:23125180 Spa17 Rat cobalt dichloride decreases expression ISO SPA17 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of SPA17 mRNA CTD PMID:19376846 Spa17 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of SPA17 mRNA CTD PMID:24386269 Spa17 Rat copper(II) sulfate decreases expression ISO SPA17 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of SPA17 mRNA CTD PMID:19549813 Spa17 Rat corosolic acid decreases expression ISO SPA17 (Homo sapiens) 6480464 corosolic acid results in decreased expression of SPA17 mRNA CTD PMID:37939859 Spa17 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of SPA17 mRNA CTD PMID:26577399 Spa17 Rat cyclosporin A affects expression ISO SPA17 (Homo sapiens) 6480464 Cyclosporine affects the expression of SPA17 mRNA CTD PMID:20106945 Spa17 Rat cyclosporin A decreases expression ISO SPA17 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of SPA17 mRNA CTD PMID:25562108 Spa17 Rat dioxygen multiple interactions ISO Spa17 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of SPA17 mRNA CTD PMID:30529165 Spa17 Rat dorsomorphin multiple interactions ISO SPA17 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Spa17 Rat doxorubicin decreases expression ISO SPA17 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of SPA17 mRNA CTD PMID:29803840 Spa17 Rat furan decreases methylation EXP 6480464 furan results in decreased methylation of SPA17 gene CTD PMID:22079235 Spa17 Rat genistein decreases expression ISO Spa17 (Mus musculus) 6480464 Genistein results in decreased expression of SPA17 mRNA CTD PMID:32186404 Spa17 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of SPA17 mRNA CTD PMID:33387578 Spa17 Rat hydrogen peroxide affects expression ISO SPA17 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of SPA17 mRNA CTD PMID:20044591 Spa17 Rat isobutanol multiple interactions ISO SPA17 (Homo sapiens) 6480464 [[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of SPA17 mRNA CTD PMID:29432896 Spa17 Rat ivermectin decreases expression ISO SPA17 (Homo sapiens) 6480464 Ivermectin results in decreased expression of SPA17 protein CTD PMID:32959892 Spa17 Rat lead diacetate affects expression EXP 6480464 lead acetate affects the expression of SPA17 mRNA CTD PMID:21864555 Spa17 Rat leflunomide decreases expression ISO SPA17 (Homo sapiens) 6480464 leflunomide results in decreased expression of SPA17 mRNA CTD PMID:28988120 Spa17 Rat levofloxacin decreases expression EXP 6480464 Levofloxacin results in decreased expression of SPA17 mRNA CTD PMID:24136188 Spa17 Rat manganese atom decreases expression ISO SPA17 (Homo sapiens) 6480464 Manganese results in decreased expression of SPA17 mRNA CTD PMID:17175027 Spa17 Rat manganese(0) decreases expression ISO SPA17 (Homo sapiens) 6480464 Manganese results in decreased expression of SPA17 mRNA CTD PMID:17175027 Spa17 Rat manganese(II) chloride decreases expression ISO SPA17 (Homo sapiens) 6480464 manganese chloride results in decreased expression of SPA17 mRNA CTD PMID:17175027 Spa17 Rat methylmercury chloride decreases expression ISO SPA17 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of SPA17 mRNA CTD PMID:28001369 Spa17 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of SPA17 mRNA CTD PMID:20360939 Spa17 Rat nitrates multiple interactions ISO Spa17 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of SPA17 mRNA CTD PMID:35964746 Spa17 Rat ozone multiple interactions ISO Spa17 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of SPA17 mRNA CTD PMID:34911549 Spa17 Rat p-toluidine increases expression EXP 6480464 4-toluidine results in increased expression of SPA17 mRNA CTD PMID:27638505 Spa17 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of SPA17 mRNA CTD PMID:33387578 Spa17 Rat perfluorooctanoic acid decreases expression ISO SPA17 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of SPA17 mRNA CTD PMID:36326898 Spa17 Rat phenethyl caffeate multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of SPA17 mRNA CTD PMID:20360939 Spa17 Rat phenobarbital affects expression ISO SPA17 (Homo sapiens) 6480464 Phenobarbital affects the expression of SPA17 mRNA CTD PMID:19159669 Spa17 Rat phenylmercury acetate multiple interactions ISO SPA17 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SPA17 mRNA CTD PMID:27188386 Spa17 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of SPA17 mRNA CTD PMID:19162173 Spa17 Rat quercetin decreases expression ISO SPA17 (Homo sapiens) 6480464 Quercetin results in decreased expression of SPA17 mRNA CTD PMID:21632981 Spa17 Rat quinolin-8-ol decreases expression ISO SPA17 (Homo sapiens) 6480464 Oxyquinoline results in decreased expression of SPA17 mRNA CTD PMID:21632981 Spa17 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of SPA17 mRNA CTD PMID:28374803 Spa17 Rat SB 431542 multiple interactions ISO SPA17 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Spa17 Rat sodium arsenite increases expression ISO SPA17 (Homo sapiens) 6480464 sodium arsenite results in increased expression of SPA17 mRNA CTD PMID:28595984 and PMID:34032870 Spa17 Rat sodium arsenite multiple interactions ISO SPA17 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SPA17 mRNA CTD PMID:39836092 Spa17 Rat sodium fluoride decreases expression ISO Spa17 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of SPA17 mRNA CTD PMID:21340527 Spa17 Rat sodium fluoride increases expression ISO Spa17 (Mus musculus) 6480464 Sodium Fluoride results in increased expression of SPA17 protein CTD PMID:28918527 Spa17 Rat sunitinib decreases expression ISO SPA17 (Homo sapiens) 6480464 Sunitinib results in decreased expression of SPA17 mRNA CTD PMID:31533062 Spa17 Rat tamoxifen affects expression ISO Spa17 (Mus musculus) 6480464 Tamoxifen affects the expression of SPA17 mRNA CTD PMID:17555576 Spa17 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of SPA17 mRNA CTD PMID:33387578 Spa17 Rat thalidomide decreases expression ISO Spa17 (Mus musculus) 6480464 Thalidomide results in decreased expression of SPA17 mRNA CTD PMID:26217789 Spa17 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of SPA17 mRNA CTD PMID:34492290 Spa17 Rat thiram decreases expression ISO SPA17 (Homo sapiens) 6480464 Thiram results in decreased expression of SPA17 mRNA CTD PMID:38568856 Spa17 Rat titanium dioxide decreases expression ISO Spa17 (Mus musculus) 6480464 titanium dioxide results in decreased expression of SPA17 mRNA CTD PMID:23557971 Spa17 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of SPA17 gene CTD PMID:27618143 Spa17 Rat trichostatin A decreases expression ISO SPA17 (Homo sapiens) 6480464 trichostatin A results in decreased expression of SPA17 mRNA CTD PMID:26272509 Spa17 Rat trichostatin A multiple interactions ISO SPA17 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SPA17 mRNA CTD PMID:27188386 Spa17 Rat triptonide increases expression ISO Spa17 (Mus musculus) 6480464 triptonide results in increased expression of SPA17 mRNA CTD PMID:33045310 Spa17 Rat urethane decreases expression ISO SPA17 (Homo sapiens) 6480464 Urethane results in decreased expression of SPA17 mRNA CTD PMID:28818685 Spa17 Rat valproic acid increases expression ISO Spa17 (Mus musculus) 6480464 Valproic Acid results in increased expression of SPA17 mRNA CTD PMID:21427059 Spa17 Rat valproic acid decreases methylation ISO SPA17 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of SPA17 gene CTD PMID:29154799 Spa17 Rat valproic acid increases expression ISO SPA17 (Homo sapiens) 6480464 Valproic Acid results in increased expression of SPA17 mRNA CTD PMID:19101580 more ... Spa17 Rat valproic acid affects expression ISO SPA17 (Homo sapiens) 6480464 Valproic Acid affects the expression of SPA17 mRNA CTD PMID:25979313 Spa17 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of SPA17 mRNA CTD PMID:22570695 Spa17 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of SPA17 mRNA CTD PMID:19015723 Spa17 Rat vorinostat increases expression ISO SPA17 (Homo sapiens) 6480464 vorinostat results in increased expression of SPA17 mRNA CTD PMID:27188386
17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (EXP,ISO) ammonium chloride (EXP) antirheumatic drug (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chloroprene (ISO) cobalt dichloride (EXP,ISO) copper(II) sulfate (ISO) corosolic acid (ISO) Cuprizon (EXP) cyclosporin A (ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) furan (EXP) genistein (ISO) gentamycin (EXP) hydrogen peroxide (ISO) isobutanol (ISO) ivermectin (ISO) lead diacetate (EXP) leflunomide (ISO) levofloxacin (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methylmercury chloride (ISO) N-nitrosodiethylamine (EXP) nitrates (ISO) ozone (ISO) p-toluidine (EXP) paracetamol (EXP) perfluorooctanoic acid (ISO) phenethyl caffeate (EXP) phenobarbital (ISO) phenylmercury acetate (ISO) pregnenolone 16alpha-carbonitrile (EXP) quercetin (ISO) quinolin-8-ol (ISO) rotenone (EXP) SB 431542 (ISO) sodium arsenite (ISO) sodium fluoride (ISO) sunitinib (ISO) tamoxifen (ISO) tetrachloromethane (EXP) thalidomide (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) triptonide (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP) vorinostat (ISO)
Spa17 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 45,496,175 - 45,507,262 (-) NCBI GRCr8 mRatBN7.2 8 37,307,432 - 37,318,519 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 37,307,557 - 37,318,639 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 41,324,053 - 41,332,966 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 39,607,116 - 39,616,029 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 37,469,996 - 37,478,909 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 40,066,954 - 40,078,131 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 40,067,076 - 40,078,165 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 40,067,778 - 40,078,956 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 38,843,007 - 38,852,080 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 38,851,772 - 38,860,846 (-) NCBI Celera 8 37,138,678 - 37,147,723 (+) NCBI Celera Cytogenetic Map 8 q22 NCBI
SPA17 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 124,673,904 - 124,697,518 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 124,673,844 - 124,697,518 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 124,543,800 - 124,567,414 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 124,048,950 - 124,069,900 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 124,048,949 - 124,069,895 NCBI Celera 11 121,703,917 - 121,724,867 (+) NCBI Celera Cytogenetic Map 11 q24.2 NCBI HuRef 11 120,486,154 - 120,507,105 (+) NCBI HuRef CHM1_1 11 124,429,875 - 124,450,825 (+) NCBI CHM1_1 T2T-CHM13v2.0 11 124,702,562 - 124,726,178 (+) NCBI T2T-CHM13v2.0
Spa17 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 37,514,590 - 37,525,018 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 37,514,586 - 37,525,018 (-) Ensembl GRCm39 Ensembl GRCm38 9 37,603,294 - 37,613,916 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 37,603,290 - 37,613,722 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 37,410,883 - 37,421,207 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 37,352,969 - 37,363,285 (-) NCBI MGSCv36 mm8 Celera 9 34,820,392 - 34,830,716 (-) NCBI Celera Cytogenetic Map 9 A4 NCBI cM Map 9 20.78 NCBI
Spa17 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955412 25,741,228 - 25,753,903 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955412 25,741,369 - 25,753,681 (+) NCBI ChiLan1.0 ChiLan1.0
SPA17 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 125,370,045 - 125,394,535 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 126,474,917 - 126,495,857 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 119,501,604 - 119,526,103 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 123,416,864 - 123,437,823 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 123,416,725 - 123,437,818 (+) Ensembl panpan1.1 panPan2
SPA17 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 9,719,222 - 9,731,521 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 9,719,241 - 9,730,913 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 9,764,084 - 9,776,377 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 9,658,863 - 9,671,169 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 9,658,882 - 9,670,560 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 9,731,014 - 9,743,307 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 9,701,457 - 9,713,751 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 9,737,971 - 9,750,271 (-) NCBI UU_Cfam_GSD_1.0
Spa17 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 106,894,523 - 106,916,177 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936743 1,141,879 - 1,163,720 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl
SPA17 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 51,918,916 - 51,931,759 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 51,918,916 - 51,931,459 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 57,436,391 - 57,448,928 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LOC103215961
Spa17
.
Predicted Target Of
Count of predictions: 118 Count of miRNA genes: 91 Interacting mature miRNAs: 99 Transcripts: ENSRNOT00000014866 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1298065 Scl16 Serum cholesterol level QTL 16 3.8 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30856404 75856404 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 11556286 Cm81 Cardiac mass QTL 81 0.01 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 30848154 61290444 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 1582222 Epfw2 Epididymal fat weight QTL 2 3.2 0.0005 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 8 31737729 76737729 Rat 1354627 Despr14 Despair related QTL 14 0.0056 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 7688955 52688955 Rat 61464 Niddm11 Non-insulin dependent diabetes mellitus QTL 11 3.1 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 35582032 80582032 Rat 61337 Bp22 Blood pressure QTL 22 5.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 42692818 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 1300146 Rf17 Renal function QTL 17 2.9 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 8 28242912 73242912 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2313088 Bss75 Bone structure and strength QTL 75 3.1 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 8 30848154 82460899 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 724514 Uae15 Urinary albumin excretion QTL 15 2.9 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 29502665 70386295 Rat 61353 Bp35 Blood pressure QTL 35 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 8 30848154 61290444 Rat 631842 Inf1 Infertility severity QTL 1 4.1 0.001 seminal gland mass (VT:0010524) seminal vesicle wet weight (CMO:0001603) 8 22662330 67662330 Rat 1359033 Bp273 Blood pressure QTL 273 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 61290444 Rat 61358 Bp39 Blood pressure QTL 39 2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 35551938 80551938 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 1331744 Bp217 Blood pressure QTL 217 3.398 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 58482492 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 1359021 Bp271 Blood pressure QTL 271 1.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 26644912 46711092 Rat 2302367 Slep5 Serum leptin concentration QTL 5 3.43 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 8 9712463 41866876 Rat 61373 Mcs4 Mammary carcinoma susceptibility QTL 4 1.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 8 16290444 61290444 Rat 70206 Alc20 Alcohol consumption QTL 20 2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 8 30848154 40713225 Rat 1357398 Slep3 Serum leptin concentration QTL 3 3.43 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 8 9712463 41866876 Rat 2313057 Bss76 Bone structure and strength QTL 76 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 8 30848154 82460899 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 2317030 Wbc5 White blood cell count QTL 5 3.21 0.005 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 8 8736635 53736635 Rat 1331804 Cm30 Cardiac mass QTL 30 3.77443 heart mass (VT:0007028) heart wet weight (CMO:0000069) 8 28242912 53961020 Rat 2313067 Bss77 Bone structure and strength QTL 77 3.1 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 8 30848154 82460899 Rat 2317032 Ginf2 Gastrointestinal inflammation QTL 2 3.21 0.005 liver integrity trait (VT:0010547) liver granuloma severity score (CMO:0002157) 8 4705810 49705810 Rat 2301416 Bp315 Blood pressure QTL 315 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 7670578 52670578 Rat 2317036 Livw3 Liver weight QTL 3 2.43 0.01 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 8 4705810 49705810 Rat 12880023 Bw184 Body weight QTL 184 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 2097640 47097640 Rat 12880028 Cm103 Cardiac mass QTL 103 0.02 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 2097640 47097640 Rat 2317051 Aia18 Adjuvant induced arthritis QTL 18 2.42 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 8 8736635 53736635 Rat 2317048 Ginf1 Gastrointestinal inflammation QTL 1 3.52 0.005 cecum mucosa thickness (VT:0010234) enterocolitis severity score (CMO:0002138) 8 4705810 49705810 Rat 12880025 Cm102 Cardiac mass QTL 102 0.044 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 8 2097640 47097640 Rat 1558646 Swd5 Spike wave discharge measurement QTL 5 3.45 0.00036 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge frequency (CMO:0001742) 8 14906751 59906751 Rat 2302278 Gluco36 Glucose level QTL 36 4.2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 29502665 50095447 Rat 12880044 Am9 Aortic mass QTL 9 0.007 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 2097640 47097640 Rat 631648 Stl5 Serum triglyceride level QTL 5 4 0.0003 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 27205715 54998217 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2303564 Gluco43 Glucose level QTL 43 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 26130187 71130187 Rat 1598824 Memor4 Memory QTL 4 2.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 8 9712220 53356647 Rat 2313046 Bss78 Bone structure and strength QTL 78 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 8 30848154 82460899 Rat 1354595 Despr4 Despair related QTL 4 2.16 0.0036 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 8 7688955 52688955 Rat 2303572 Insul13 Insulin level QTL 13 2 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 8 26130187 71130187 Rat
RH139440
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 37,307,500 - 37,307,677 (+) MAPPER mRatBN7.2 Rnor_6.0 8 40,067,023 - 40,067,199 NCBI Rnor6.0 Rnor_5.0 8 40,067,847 - 40,068,023 UniSTS Rnor5.0 RGSC_v3.4 8 38,842,908 - 38,843,084 UniSTS RGSC3.4 Celera 8 37,147,646 - 37,147,822 UniSTS RH 3.4 Map 8 342.7 UniSTS Cytogenetic Map 8 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000014866 ⟹ ENSRNOP00000014866
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 37,307,557 - 37,318,639 (-) Ensembl Rnor_6.0 Ensembl 8 40,067,076 - 40,078,165 (-) Ensembl
RefSeq Acc Id:
NM_053482 ⟹ NP_445934
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 45,496,175 - 45,507,262 (-) NCBI mRatBN7.2 8 37,307,432 - 37,318,519 (-) NCBI Rnor_6.0 8 40,067,122 - 40,076,195 (-) NCBI Rnor_5.0 8 40,067,778 - 40,078,956 (-) NCBI RGSC_v3.4 8 38,843,007 - 38,852,080 (-) RGD Celera 8 37,138,678 - 37,147,723 (+) RGD
Sequence:
ATGTCGATTCCTTTCTCCAACACCCACTACCGAATTCCACAAGGATTTGGAAATCTTCTTGAAGGGCTGACACGGGAGATTCTGAGGGAGCAACCGGACAATATACCAGCTTTTGCCGCAGCGTATTT
hide sequence
RefSeq Acc Id:
XM_017595948 ⟹ XP_017451437
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 45,496,296 - 45,506,791 (-) NCBI mRatBN7.2 8 37,307,432 - 37,318,140 (-) NCBI Rnor_6.0 8 40,066,954 - 40,077,924 (-) NCBI
Sequence:
TCCCGCAATTCCTGGACCAGATAGGGAGCCTGGCAAGCCCTTTCTGGGAGAACCTGGAACTCTA
hide sequence
RefSeq Acc Id:
NP_445934 ⟸ NM_053482
- UniProtKB:
Q9Z1K2 (UniProtKB/TrEMBL), A6KRK5 (UniProtKB/TrEMBL), F7FLV9 (UniProtKB/TrEMBL)
- Sequence:
MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFENLLEKREKTSFDPAEWGAKVEDRFYNNHAFKDPEQAEKCEQEIAKASGREETPVTPFEESTEEEREQEEAAVKIQSAFRGHVAR
hide sequence
RefSeq Acc Id:
XP_017451437 ⟸ XM_017595948
- Peptide Label:
isoform X1
- UniProtKB:
Q9Z1K2 (UniProtKB/TrEMBL), A6KRK5 (UniProtKB/TrEMBL), F7FLV9 (UniProtKB/TrEMBL)
- Sequence:
MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFENLLEKREKTSFDPAEWGAKV
hide sequence
Ensembl Acc Id:
ENSRNOP00000014866 ⟸ ENSRNOT00000014866
RGD ID: 13695863 Promoter ID: EPDNEW_R6388 Type: initiation region Name: Spa17_2 Description: sperm autoantigenic protein 17 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R6389 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 40,078,041 - 40,078,101 EPDNEW
RGD ID: 13695864 Promoter ID: EPDNEW_R6389 Type: single initiation site Name: Spa17_1 Description: sperm autoantigenic protein 17 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R6388 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 40,078,173 - 40,078,233 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Spa17
sperm autoantigenic protein 17
Sp17
Symbol updated
1299863 APPROVED
2002-08-07
Sp17
sperm autoantigenic protein 17
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_physical_interaction
binds A-kinase anchoring protein 3 (Akap3)
1303351
