Advanced Search (OLGA)

Gene: Gdf6 (growth differentiation factor 6) Rattus norvegicus

Analyze

Symbol:

Gdf6

Name:

growth differentiation factor 6

RGD ID:

620104

Description:

Predicted to enable cytokine activity and identical protein binding activity. Predicted to be involved in several processes, including positive regulation of chondrocyte differentiation; positive regulation of intracellular signal transduction; and transforming growth factor beta receptor superfamily signaling pathway. Predicted to act upstream of or within with a positive effect on cell migration involved in metanephros development and epithelial cell migration. Predicted to act upstream of or within positive regulation of neuron differentiation. Predicted to be located in extracellular region. Predicted to be active in extracellular space. Human ortholog(s) of this gene implicated in Leber congenital amaurosis 17; bone disease (multiple); cleft lip; cleft palate; and isolated microphthalmia 4. Orthologous to human GDF6 (growth differentiation factor 6); PARTICIPATES IN transforming growth factor-beta superfamily mediated signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; ammonium chloride; beta-naphthoflavone.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

BMP-13; bone morphogenetic protein 13; GDF-6; gdf16; growth differentiation factor 16; growth/differentiation factor 16; growth/differentiation factor 6

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GDF6 (growth differentiation factor 6)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Gdf6 (growth differentiation factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gdf6 (growth differentiation factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GDF6 (growth differentiation factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GDF6 (growth differentiation factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gdf6 (growth differentiation factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GDF6 (growth differentiation factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GDF6 (growth differentiation factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gdf6 (growth differentiation factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Gdf6 (growth differentiation factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	GDF6 (growth differentiation factor 6)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gdf6 (growth differentiation factor 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gdf6a (growth differentiation factor 6a)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gdf6b (growth differentiation factor 6b)	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gdf6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	27,793,561 - 27,809,884 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	27,793,552 - 27,811,825 (+)	Ensembl				GRCr8
mRatBN7.2	5	22,996,246 - 23,012,567 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	22,996,246 - 23,012,567 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	25,230,195 - 25,246,549 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	26,816,190 - 26,832,510 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	26,596,487 - 26,612,805 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	23,056,345 - 23,072,666 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	23,056,347 - 23,074,599 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	27,786,775 - 27,803,096 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	23,739,175 - 23,756,140 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	22,249,415 - 22,265,738 (+)	NCBI		Celera
RGSC_v3.1	5	23,755,784 - 23,755,986 (+)	NCBI
Cytogenetic Map	5	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

CAKUT (ISO)

cleft lip (ISO)

cleft palate (ISO)

Desbuquois dysplasia (ISO)

fundus dystrophy (ISO)

genetic disease (ISO)

isolated microphthalmia 4 (ISO)

Isolated Microphthalmia with Coloboma 6 (ISO)

Klippel-Feil syndrome (ISO)

Klippel-Feil syndrome 1 (ISO)

Leber congenital amaurosis 17 (ISO)

multiple synostoses syndrome 4 (ISO)

retinitis pigmentosa 1 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,4'-trichlorobiphenyl (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3-Nitrobenzanthrone (ISO)

4,4'-sulfonyldiphenol (ISO)

acrolein (ISO)

alpha-pinene (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

beta-naphthoflavone (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP)

bisphenol F (ISO)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cannabidiol (EXP)

CGP 52608 (ISO)

cisplatin (ISO)

crotonaldehyde (ISO)

diclofenac (EXP)

dioxygen (EXP,ISO)

doxorubicin (ISO)

endosulfan (EXP)

ethylparaben (ISO)

fipronil (EXP)

furan (EXP)

genistein (ISO)

gentamycin (EXP)

indometacin (ISO)

inulin (ISO)

N-nitrosodiethylamine (EXP)

nitrofen (EXP)

Nor-9-carboxy-delta9-THC (ISO)

ozone (ISO)

paracetamol (EXP)

PCB138 (ISO)

perfluorooctane-1-sulfonic acid (ISO)

potassium chromate (ISO)

sodium arsenite (ISO)

tamoxifen (ISO)

testosterone (ISO)

titanium dioxide (ISO)

triclosan (ISO)

tunicamycin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

activin receptor signaling pathway (ISO)

apoptotic process (IEA,ISS)

BMP signaling pathway (IBA,IEA,ISO,ISS)

cell migration (ISO)

fat cell differentiation (IEA,ISO,ISS)

metanephros development (IBA,IEA,ISO)

positive regulation of cell differentiation (IEA)

positive regulation of chondrocyte differentiation (ISO,ISS)

positive regulation of DNA-templated transcription (ISO)

positive regulation of neuron differentiation (ISO)

positive regulation of p38MAPK cascade (IEA,ISO,ISS)

positive regulation of SMAD protein signal transduction (IEA,ISO,ISS)

retinal cell apoptotic process (ISS)

Cellular Component

extracellular region (IEA)

extracellular space (IBA,IEA,NAS)

Molecular Function

cytokine activity (IBA,IEA)

growth factor activity (IEA)

identical protein binding (IEA,ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

transforming growth factor-beta superfamily mediated signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Genomic screening identifies novel linkages and provides further evidence for a role of MYH9 in nonsyndromic cleft lip and palate.	Chiquet BT, etal., Eur J Hum Genet. 2009 Feb;17(2):195-204. doi: 10.1038/ejhg.2008.149. Epub 2008 Aug 20.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Gene expression of growth differentiation factors in the developing periodontium of rat molars.	Sena K, etal., J Dent Res 2003 Mar;82(3):166-71.

Additional References at PubMed

PMID:9786991	PMID:16049014	PMID:21469182	PMID:24006456	PMID:26643732	PMID:26774823

Genomics

Comparative Map Data

Gdf6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	27,793,561 - 27,809,884 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	27,793,552 - 27,811,825 (+)	Ensembl				GRCr8
mRatBN7.2	5	22,996,246 - 23,012,567 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	22,996,246 - 23,012,567 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	25,230,195 - 25,246,549 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	26,816,190 - 26,832,510 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	26,596,487 - 26,612,805 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	23,056,345 - 23,072,666 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	23,056,347 - 23,074,599 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	27,786,775 - 27,803,096 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	23,739,175 - 23,756,140 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	22,249,415 - 22,265,738 (+)	NCBI		Celera
RGSC_v3.1	5	23,755,784 - 23,755,986 (+)	NCBI
Cytogenetic Map	5	q13	NCBI

GDF6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	96,142,333 - 96,160,806 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	96,142,333 - 96,160,806 (-)	Ensembl			hg38	GRCh38
GRCh37	8	97,154,561 - 97,173,034 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	97,223,734 - 97,242,196 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	8	97,223,737 - 97,242,196	NCBI
Celera	8	93,340,541 - 93,359,001 (-)	NCBI		Celera
Cytogenetic Map	8	q22.1	NCBI
HuRef	8	92,360,118 - 92,378,582 (-)	NCBI		HuRef
CHM1_1	8	97,194,809 - 97,213,265 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	8	97,267,652 - 97,286,137 (-)	NCBI		T2T-CHM13v2.0

Gdf6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	9,844,372 - 9,862,345 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	9,844,372 - 9,862,345 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	9,844,372 - 9,862,345 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	9,844,372 - 9,862,345 (+)	Ensembl			mm10	GRCm38
MGSCv37	4	9,771,519 - 9,789,492 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	9,771,519 - 9,789,492 (+)	NCBI		MGSCv36	mm8
Celera	4	9,660,031 - 9,677,998 (+)	NCBI		Celera
Cytogenetic Map	4	A1	NCBI
cM Map	4	4.35	NCBI

Gdf6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955417	12,152,448 - 12,169,362 (-)	Ensembl
ChiLan1.0	NW_004955417	12,152,448 - 12,169,173 (-)	NCBI	ChiLan1.0	ChiLan1.0

GDF6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	113,474,794 - 113,493,871 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	89,013,655 - 89,032,096 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	92,767,401 - 92,785,955 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	94,965,399 - 94,984,456 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2

GDF6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	29	40,676,851 - 40,694,174 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	29	40,676,851 - 40,694,174 (-)	NCBI			canFam3	CanFam3.1
CanFam3.1 Ensembl	29	40,676,851 - 40,694,174 (-)	Ensembl			canFam3	CanFam3.1
ROS_Cfam_1.0	29	40,868,628 - 40,885,256 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	29	40,866,233 - 40,885,365 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UNSW_CanFamBas_1.0	29	40,880,805 - 40,897,837 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	29	41,342,023 - 41,361,005 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gdf6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	38,894,428 - 38,952,490 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936470	46,361,451 - 46,377,594 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936470	46,361,528 - 46,379,576 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GDF6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	40,472,935 - 40,490,033 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	40,473,015 - 40,491,142 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

GDF6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	91,105,663 - 91,124,059 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	91,107,857 - 91,123,874 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666039	49,663,846 - 49,682,176 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gdf6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624763	3,474,671 - 3,490,297 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624763	3,473,047 - 3,490,346 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Gdf6
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	133,671,380 - 133,687,502 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Gdf6
182 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	76
Count of miRNA genes:	71
Interacting mature miRNAs:	76
Transcripts:	ENSRNOT00000010266
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2293666	Bmd38	Bone mineral density QTL 38	4.4		femur size trait (VT:1000369)	femoral neck cortical cross-sectional area (CMO:0001702)	5	13731153	43590997	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	6922282	81330203	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	23671493	79046465	Rat
1300117	Hrtrt8	Heart rate QTL 8	3.49		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	8627230	52665523	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	14606078	59606078	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	17576633	62576633	Rat
1578774	Tcas8	Tongue tumor susceptibility QTL 8	3.47		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	15707451	60707451	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	10019064	91770353	Rat
2312562	Pur18	Proteinuria QTL 18	2.6	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	5	6922282	37468560	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	7065535	74335773	Rat
1641903	Alcrsp3	Alcohol response QTL 3			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	17486080	62486080	Rat
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	10019064	87027358	Rat
8552954	Pigfal14	Plasma insulin-like growth factor 1 level QTL 14	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	26023211	71023211	Rat
2303577	Gluco47	Glucose level QTL 47	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	16520019	61520019	Rat
1641922	Alcrsp8	Alcohol response QTL 8			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	5	17486080	62486080	Rat
2313085	Bss59	Bone structure and strength QTL 59	2.9	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	5	8627230	53627230	Rat
1600358	Mamtr5	Mammary tumor resistance QTL 5			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	23671493	68671493	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
9	7	55	104	80	83	56	22	56	6	203	98	1	86	36	80	27	9	9

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001013038	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB087405	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ537426	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473984	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010266 ⟹ ENSRNOP00000010266

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	5	23,056,347 - 23,074,599 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000101359 ⟹ ENSRNOP00000082414

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	27,793,552 - 27,811,825 (+)	Ensembl
mRatBN7.2 Ensembl	5	22,996,246 - 23,012,567 (+)	Ensembl

RefSeq Acc Id:

NM_001013038 ⟹ NP_001013056

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	27,793,561 - 27,809,884 (+)	NCBI
mRatBN7.2	5	22,996,246 - 23,012,567 (+)	NCBI
Rnor_6.0	5	23,056,345 - 23,072,666 (+)	NCBI
Rnor_5.0	5	27,786,775 - 27,803,096 (+)	NCBI
RGSC_v3.4	5	23,739,175 - 23,756,140 (+)	RGD
Celera	5	22,249,415 - 22,265,738 (+)	RGD

Sequence:

show sequence

AGGAGGAACGCGGCCCCCGCCGCTGTCCAGCTGCTCCGTGCCTTTCGCGCCCGGCGCAGCCACC
GCTGTCGCCGCCGCCTCTCGGAGAAACTCAGCCACTCTCTCGCCATGGACACTCCTAGGGTCCT
TCTCTGGGCGATCTTCCTCATCAGCTTCCTCTGGGATTTGCCGGGTTTCCAGCAGGCTTCCATC
TCCTCGTCCTCCTCCACCGAATTGGACTCCACCAAGGACGTGGAGAACCGCAAGGGAGGGAAGA
TGCAGCGGACTCCCCAAGAGAGTGCCGAGGGCCGGACGCCCAAGGAGCACCGGCCGCGGCCGAA
TGAGCTCAGGCGGCGACTGCCGGGACAATCTCTGGGGCAGGAGCCGCCGGGCAGGGGGCCGCGC
GTGGTGCCTCACGAGTACATGCTGTCAATCTACAGGACTTACTCCATTGCCGAGAAGCTGGGCA
TCAATGCCAGCTTTTTCCAGTCTTCCAAGTCAGCTAATACGATCACTAGCTTTGTAGACAGAGG
ACTGGACGATCTCTCGCACACTCCTCTCCGGAGACAGAAGTATTTGTTTGATGTGTCCACGCTC
TCAGACAAAGAAGAGCTGGTGGGCGCAGAGCTGAGGCTTTATCGCCAGGCGCCCCCAACGCCCT
GGGGGCCACAAACCCGACCGCTGCATTTGCAGCTCTTCCCCTGTTTGTCCCCATTGTTACTGGA
CTCTAGGACCCTGGATCCTCAGGGGCCAACAGAAGCTGGCTGGGAAGTTTTCGACGTGTGGCAG
GTCCTGCGCCCTCAGCCGTGGAAGCAGCTGTGCTTGGAGCTTCGGGCAGTCTGGGGTGAGCTGG
ACGCCAGGGATTCAGGAGCGCGCCCGAGGGGTCCCCAACAGTCACCGCCCCTGGACCTGCGGAG
TCTGGGCTTCGGCCGGAGGGTGCGGCCGCCCCAGGAGCGCGCCCTGCTTGTCGTGTTCACCAGA
TCGCAGCGCAAGAACCTGTTCACTGAGATGCATGAGCAGCTGGGCTCTGCAGAGGCTGCCGGAG
CCGAGGGGTCATGGCCAGCGCCGTCGGGCGCCCCAGACGCCGGGTCTTGGCTGCCCTCGCCCGG
CCGCCGGCGGCGACGCACCGCCCTCAGCAGCCGTCACGGCAAGCGACACGGCAAGAAGTCCAGG
CTGCGCTGCAGCAGAAAACCTCTGCACGTGAATTTTAAGGAGTTAGGCTGGGACGATTGGATTA
TCGCGCCCCTAGAGTACGAGGCCTATCACTGCGAGGGCGTGTGCGACTTTCCGCTGCGCTCGCA
CCTGGAGCCCACCAACCATGCCATCATCCAAACGCTGATGAACTCCATGGACCCGGGCTCCACC
CCACCCAGCTGCTGTGTTCCCACCAAATTGACTCCCATCAGCATCCTGTACATCGATGCGGGCA
ATAATGTGGTCTACAAGCAGTACGAGGACATGGTGGTGGAGTCCTGTGGTTGTAGGTAGCGGTG
CTGTCCCGCCTCCTGGGCCAGGGACCACGGAGGAAGGCCTAACTGCTGAGAGAGAAGCAGGAGC
TGTCCTGGAAGAGGCCACAGGTGGGGGACAGCATGAAAGT

hide sequence

Protein Sequences


Protein RefSeqs	NP_001013056	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAC02714	(Get FASTA)	NCBI Sequence Viewer
	CAD60936	(Get FASTA)	NCBI Sequence Viewer
	EDM11664	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000082414
	ENSRNOP00000082414.1
GenBank Protein	Q6HA10	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001013056 ⟸ NM_001013038
- Peptide Label:	precursor
- UniProtKB:	Q8K4X4 (UniProtKB/Swiss-Prot), Q6HA10 (UniProtKB/Swiss-Prot), A6JFR8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MDTPRVLLWAIFLISFLWDLPGFQQASISSSSSTELDSTKDVENRKGGKMQRTPQESAEGRTPK EHRPRPNELRRRLPGQSLGQEPPGRGPRVVPHEYMLSIYRTYSIAEKLGINASFFQSSKSANTI TSFVDRGLDDLSHTPLRRQKYLFDVSTLSDKEELVGAELRLYRQAPPTPWGPQTRPLHLQLFPC LSPLLLDSRTLDPQGPTEAGWEVFDVWQVLRPQPWKQLCLELRAVWGELDARDSGARPRGPQQS PPLDLRSLGFGRRVRPPQERALLVVFTRSQRKNLFTEMHEQLGSAEAAGAEGSWPAPSGAPDAG SWLPSPGRRRRRTALSSRHGKRHGKKSRLRCSRKPLHVNFKELGWDDWIIAPLEYEAYHCEGVC DFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVES CGCR hide sequence

Ensembl Acc Id:

ENSRNOP00000010266 ⟸ ENSRNOT00000010266

Ensembl Acc Id:

ENSRNOP00000082414 ⟸ ENSRNOT00000101359

Protein Domains

TGF-beta family profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6HA10-F1-model_v2	AlphaFold	Q6HA10	1-452	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693559

Promoter ID:

EPDNEW_R4083

Type:

multiple initiation site

Name:

Gdf6_1

Description:

growth differentiation factor 6

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	23,056,332 - 23,056,392	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620104	AgrOrtholog
BioCyc Gene	G2FUF-41990	BioCyc
Ensembl Genes	ENSRNOG00000007810	Ensembl
	ENSRNOG00000067800	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000101359	ENTREZGENE
	ENSRNOT00000101359.1	UniProtKB/Swiss-Prot
Gene3D-CATH	2.10.90.10	UniProtKB/Swiss-Prot
	2.60.120.970	UniProtKB/Swiss-Prot
InterPro	Cystine-knot_cytokine	UniProtKB/Swiss-Prot
	TGF-b_C	UniProtKB/Swiss-Prot
	TGF-b_propeptide	UniProtKB/Swiss-Prot
	TGF-beta-rel	UniProtKB/Swiss-Prot
	TGFb_CS	UniProtKB/Swiss-Prot
KEGG Report	rno:252834	UniProtKB/Swiss-Prot
NCBI Gene	252834	ENTREZGENE
PANTHER	GROWTH/DIFFERENTIATION FACTOR 6	UniProtKB/Swiss-Prot
	PTHR11848	UniProtKB/Swiss-Prot
Pfam	TGF_beta	UniProtKB/Swiss-Prot
	TGFb_propeptide	UniProtKB/Swiss-Prot
PhenoGen	Gdf6	PhenoGen
PRINTS	INHIBINA	UniProtKB/Swiss-Prot
PROSITE	TGF_BETA_1	UniProtKB/Swiss-Prot
	TGF_BETA_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000007810	RatGTEx
	ENSRNOG00000067800	RatGTEx
SMART	TGFB	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF57501	UniProtKB/Swiss-Prot
UniProt	A6JFR8	ENTREZGENE, UniProtKB/TrEMBL
	GDF6_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q8K4X4	ENTREZGENE
UniProt Secondary	Q8K4X4	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-01-20	Gdf6	growth differentiation factor 6			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Gdf6	growth differentiation factor 6			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)