Advanced Search (OLGA)

Gene: Eya2 (EYA transcriptional coactivator and phosphatase 2) Rattus norvegicus

Analyze

Symbol:

Eya2

Name:

EYA transcriptional coactivator and phosphatase 2

RGD ID:

620096

Description:

Predicted to enable histone H2AXY142 phosphatase activity; magnesium ion binding activity; and protein tyrosine phosphatase activity. Predicted to be involved in cell differentiation; negative regulation of extrinsic apoptotic signaling pathway in absence of ligand; and positive regulation of DNA repair. Predicted to act upstream of or within extrinsic apoptotic signaling pathway in absence of ligand; mitochondrial outer membrane permeabilization; and striated muscle tissue development. Predicted to be located in cytoplasm. Predicted to be active in nucleus. Orthologous to human EYA2 (EYA transcriptional coactivator and phosphatase 2); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Drosophila-type eyes absent 2-like protein; eyes absent 2; eyes absent 2 homolog; eyes absent 2 homolog (Drosophila); eyes absent homolog 2; eyes absent homolog 2 (Drosophila)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	174,754,772 - 174,938,035 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	174,818,554 - 174,938,034 (+)	Ensembl				GRCr8
mRatBN7.2	3	154,335,598 - 154,519,006 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	154,335,400 - 154,518,793 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	158,214,097 - 158,322,360 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	166,713,095 - 166,821,357 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	164,454,709 - 164,562,989 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	162,285,275 - 162,470,642 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	162,346,490 - 162,470,065 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	168,527,052 - 168,647,898 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	156,731,490 - 156,848,691 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	153,000,284 - 153,109,100 (+)	NCBI		Celera
RGSC_v3.1	3	156,685,847 - 156,746,476 (+)	NCBI
Cytogenetic Map	3	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

hereditary breast ovarian cancer syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrylamide (EXP,ISO)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

benzbromarone (ISO)

benzo[a]pyrene (EXP,ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

Butylbenzyl phthalate (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbamazepine (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

cocaine (EXP)

crocidolite asbestos (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

dibutyl phthalate (ISO)

diethyl phthalate (ISO)

diisobutyl phthalate (ISO)

diisononyl phthalate (ISO)

dorsomorphin (ISO)

elemental selenium (ISO)

fenvalerate (EXP)

flavonoids (EXP)

fulvestrant (ISO)

genistein (ISO)

glycidol (EXP)

glyphosate (EXP)

methoxychlor (EXP)

methylmercury chloride (ISO)

Moniliformin (ISO)

N-Nitrosopyrrolidine (ISO)

nickel atom (ISO)

nickel sulfate (ISO)

O-methyleugenol (ISO)

paracetamol (EXP,ISO)

perfluorooctanoic acid (EXP)

phenylephrine (EXP)

phenylmercury acetate (ISO)

potassium chromate (ISO)

resveratrol (ISO)

retinyl acetate (ISO)

SB 431542 (ISO)

selenium atom (ISO)

sodium arsenite (ISO)

Soman (EXP)

streptozocin (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

trimellitic anhydride (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell differentiation (IBA)

chromatin remodeling (IEA)

DNA damage response (IEA)

DNA repair (IEA)

DNA-templated transcription (IEA)

extrinsic apoptotic signaling pathway in absence of ligand (ISO)

mitochondrial outer membrane permeabilization (ISO)

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand (IBA)

positive regulation of DNA repair (IBA)

protein dephosphorylation (ISO)

striated muscle tissue development (ISO)

Cellular Component

cytoplasm (IEA,ISO)

cytosol (IEA,ISO)

mitochondrion (IEA)

nucleus (IBA,IEA,ISO)

Molecular Function

histone H2AXY142 phosphatase activity (IEA,ISO)

hydrolase activity (IEA)

magnesium ion binding (IEA,ISO)

metal ion binding (IEA)

phosphoprotein phosphatase activity (IEA)

protein binding (ISO)

protein tyrosine phosphatase activity (IBA,IEA,ISO)

transcription factor binding (IPI)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Transcription coactivator Eya2 is a critical regulator of physiological hypertrophy.	Lee SH, etal., J Mol Cell Cardiol. 2012 Mar;52(3):718-26. doi: 10.1016/j.yjmcc.2011.12.002. Epub 2011 Dec 14.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	Cooperation of six and eya in activation of their target genes through nuclear translocation of Eya.	Ohto H, etal., Mol Cell Biol 1999 Oct;19(10):6815-24.
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:11700312	PMID:14628052	PMID:17098221	PMID:19351884

Genomics

Comparative Map Data

Eya2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	174,754,772 - 174,938,035 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	174,818,554 - 174,938,034 (+)	Ensembl				GRCr8
mRatBN7.2	3	154,335,598 - 154,519,006 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	154,335,400 - 154,518,793 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	158,214,097 - 158,322,360 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	166,713,095 - 166,821,357 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	164,454,709 - 164,562,989 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	162,285,275 - 162,470,642 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	162,346,490 - 162,470,065 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	168,527,052 - 168,647,898 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	156,731,490 - 156,848,691 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	153,000,284 - 153,109,100 (+)	NCBI		Celera
RGSC_v3.1	3	156,685,847 - 156,746,476 (+)	NCBI
Cytogenetic Map	3	q42	NCBI

EYA2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	46,894,843 - 47,188,844 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	46,894,587 - 47,188,844 (+)	Ensembl			hg38	GRCh38
GRCh37	20	45,523,482 - 45,817,492 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	44,956,916 - 45,250,899 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	20	45,040,280 - 45,250,897	NCBI
Celera	20	42,236,954 - 42,531,188 (+)	NCBI		Celera
Cytogenetic Map	20	q13.12	NCBI
HuRef	20	42,266,395 - 42,561,039 (+)	NCBI		HuRef
CHM1_1	20	45,426,259 - 45,720,382 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	20	48,632,937 - 48,926,940 (+)	NCBI		T2T-CHM13v2.0

Eya2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	165,436,892 - 165,613,645 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	165,436,952 - 165,613,647 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	165,595,028 - 165,771,727 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	165,595,032 - 165,771,727 (+)	Ensembl			mm10	GRCm38
MGSCv37	2	165,480,798 - 165,597,131 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	165,346,503 - 165,462,836 (+)	NCBI		MGSCv36	mm8
Celera	2	171,595,465 - 171,708,914 (+)	NCBI		Celera
Cytogenetic Map	2	H3	NCBI
cM Map	2	85.83	NCBI

Eya2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955445	10,369,514 - 10,603,953 (-)	Ensembl
ChiLan1.0	NW_004955445	10,368,869 - 10,520,246 (-)	NCBI	ChiLan1.0	ChiLan1.0

EYA2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	52,629,651 - 52,923,413 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	52,622,756 - 52,916,518 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	43,226,621 - 43,520,301 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	44,310,517 - 44,603,846 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	44,310,451 - 44,607,468 (+)	Ensembl			panPan2	panpan1.1

EYA2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	34,126,086 - 34,308,412 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	34,082,197 - 34,308,423 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	33,504,631 - 33,767,623 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	34,753,206 - 35,017,240 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	34,802,105 - 35,017,234 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	34,009,635 - 34,272,364 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	34,127,141 - 34,390,163 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	34,666,914 - 34,930,928 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Eya2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	190,770,099 - 190,949,251 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936514	6,223,719 - 6,341,326 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936514	6,223,745 - 6,401,985 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

EYA2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	48,966,814 - 49,243,739 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	17	48,930,682 - 49,243,789 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	54,833,230 - 55,078,393 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

EYA2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	16,717,300 - 17,001,893 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	16,717,291 - 17,001,703 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666050	65,351,749 - 65,637,914 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Eya2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624790	7,620,756 - 7,775,933 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624790	7,620,935 - 7,852,072 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Eya2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	5	152,193,346 - 152,297,994 (-)	NCBI		Rrattus_CSIRO_v1

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	81
Count of miRNA genes:	66
Interacting mature miRNAs:	68
Transcripts:	ENSRNOT00000030119
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
12879876	Bw182	Body weight QTL 182		0.003	body mass (VT:0001259)	body weight (CMO:0000012)	3	141555229	186555229	Rat
2301411	Bp320	Blood pressure QTL 320		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	141555229	186555229	Rat
1582233	Insul10	Insulin level QTL 10	5.4	0.0015	blood insulin amount (VT:0001560)	serum insulin level times blood glucose level (CMO:0002040)	3	133259579	178259579	Rat
1300113	Bp176	Blood pressure QTL 176	3.9		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	166376089	177728348	Rat
12879872	Cm97	Cardiac mass QTL 97		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	141555229	186555229	Rat
12879873	Cm96	Cardiac mass QTL 96		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	141555229	186555229	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	151075912	189428310	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	129154923	182114333	Rat
12879874	Cm98	Cardiac mass QTL 98		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	141555229	186555229	Rat
12879875	Kidm64	Kidney mass QTL 64		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	141555229	186555229	Rat
1298068	Bp167	Blood pressure QTL 167		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	161492708	189428310	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	51581665	184004958	Rat
8552791	Vie2	Viral induced encephalitis QTL 2	4.1		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	3	166376089	189428310	Rat
61335	Bp20	Blood pressure QTL 20	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	161799493	176036425	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	133134628	178134628	Rat
1331726	Bp208	Blood pressure QTL 208	3.129		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	161799270	187311134	Rat
1582213	Insul6	Insulin level QTL 6	3.7	0.0009	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	3	155759447	189428310	Rat
1598854	Memor10	Memory QTL 10	2		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	3	166376089	189428310	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	152055202	189428310	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	142898802	187898802	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	79649560	177741895	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	145335553	189428310	Rat
1582256	Insul9	Insulin level QTL 9	4.4	0.0016	blood insulin amount (VT:0001560)	absolute change in serum insulin level (CMO:0002038)	3	155759447	189428310	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	139299381	184299381	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	141508991	177728348	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	131036586	176036586	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	137114333	182114333	Rat
1582248	Insul7	Insulin level QTL 7	3.9	0.0041	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	3	155759447	189428310	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	131036586	176036586	Rat
1578666	Vnigr1	Vascular neointimal growth QTL 1	4.6		artery morphology trait (VT:0002191)	artery lumen area (CMO:0001409)	3	151075912	189428310	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	151075912	189428310	Rat
12879871	Am7	Aortic mass QTL 7		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	141555229	186555229	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	144575244	189428310	Rat

Markers in Region

D13Mit224

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	1,030,618 - 1,030,731 (-)	MAPPER	mRatBN7.2
mRatBN7.2	3	154,440,566 - 154,441,900 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	162,387,094 - 162,388,427	NCBI	Rnor6.0
Rnor_6.0	17	1,607,243 - 1,607,355	NCBI	Rnor6.0
Rnor_5.0	17	1,596,799 - 1,596,911	UniSTS	Rnor5.0
Rnor_5.0	3	168,566,785 - 168,568,118	UniSTS	Rnor5.0
RGSC_v3.4	3	156,762,172 - 156,763,505	UniSTS	RGSC3.4
RGSC_v3.4	17	6,557,554 - 6,557,666	UniSTS	RGSC3.4
Celera	17	1,486,353 - 1,486,465	UniSTS
Celera	3	153,029,202 - 153,030,535	UniSTS
Cytogenetic Map	3	q42	UniSTS
Cytogenetic Map	17	p14	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	161	91	90	59	92	59	6	356	192	11	138	81	92	31	16	16

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001430138	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001430139	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_130427	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104163	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104164	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104165	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063283024	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB073099	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY366465	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000030119 ⟹ ENSRNOP00000030502

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	174,818,554 - 174,938,034 (+)	Ensembl
mRatBN7.2 Ensembl	3	154,335,400 - 154,518,793 (+)	Ensembl
Rnor_6.0 Ensembl	3	162,357,356 - 162,470,065 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000087530 ⟹ ENSRNOP00000071977

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	174,818,554 - 174,938,034 (+)	Ensembl
mRatBN7.2 Ensembl	3	154,399,173 - 154,518,793 (+)	Ensembl
Rnor_6.0 Ensembl	3	162,346,490 - 162,465,465 (+)	Ensembl

RefSeq Acc Id:

NM_130427 ⟹ NP_569111

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	174,754,876 - 174,938,035 (+)	NCBI
mRatBN7.2	3	154,335,598 - 154,518,780 (+)	NCBI
Rnor_6.0	3	162,357,356 - 162,470,065 (+)	NCBI
Rnor_5.0	3	168,527,052 - 168,647,898 (+)	NCBI
RGSC_v3.4	3	156,731,490 - 156,848,691 (+)	RGD
Celera	3	153,000,284 - 153,109,100 (+)	RGD

Sequence:

show sequence

ATGTTAGAAGTGGTGATCTCACCCAGCCTCGCAGCAAGCAGTGACTGGGGCGAGCACGGTGCGG
CCGTGGGGGCGCTGACTGACAGAGAAGGCACCGCCAAAGCAGCCTCTCTGAGTGTCCCTCAGCT
CTTTGCGAAGTCTCACCCACGTGTCCCTCCGGGTCAGTCCTCTGCAGCCATGGCAGCCTATGGC
CAGACACAGTACAGCACAGGCATCCAGCAGACGCCACCCTATACAGCGTACCCACCTCCGGCGC
AAGCCTATGGAATCCCCCCTTACAGTATCAAGACAGAAGACAGTTTGAATCACTCGCCCAGCCA
GAGTGGGTTCCTGAGCTACGGACCGAGCTTCAGCACCGCGCCTGCTGGACAGAGCCCCTACACC
TACCCAGTGCACAGCACCGCAGGGCTCTATCAAGGCGCCAACGGATTGACCAACACGGCCGGAT
TTGGGAGCGTGCACCAGGATTACCCCTCCTACCCCAACTTCCCACAGAACCAGTACCCCCAGTA
TTTCAGCCCATCATACAACCCGCCCTATGTCCCAGCCAGCAGCCTCTGCTCCTCGCCCCTCTCC
ACGTCCACCTACGTCCTCCAGGAGGCTCCTCACAATGTCAGCCAGAGTTCTGAGTCACTGGCCG
GAGACTACAACACACACAACGGACCCTCCACGCCAGCAAAGGAGGGTGACACAGACAGGCCACA
TCGGGCCTCGGATGGGAAACTACGGGGCCGGTCAAAGAGGAGTAGTGACCCCTCCCCAGTAGGA
GACAATGAAATTGAGCGCGTGTTCGTCTGGGACCTGGACGAGACAATCATCATTTTCCACTCCC
TGCTCACAGGAACGTTCGCATCCAGATATGGGAAGGACACCACGACGTCAGTGCGCATCGGCCT
GATGATGGAGGAGATGATCTTCAACCTCGCTGACACACACCTGTTCTTCAATGACCTGGAGGAC
TGTGACCAAATCCACGTGGATGATGTCTCATCCGATGACAATGGCCAGGACTTAAGCACATACA
ACTTCTCCACTGATGGTTTCCACAGCACGGCGCCAGGGGCCAGCTTGTGCCTGGGTACAGGTGT
TCACGGCGGTGTGGATTGGATGAGGAAACTAGCCTTCCGCTACCGTCGGGTGAAGGAGATGTAC
AATACCTACCGCAACAACGTGGGCGGCTTGATAGGCGCTCCCAAAAGAGAGACATGGCTGCAGC
TGCGCGCTGAGCTGGAGGCCCTGACTGACCTCTGGCTCACCCACTCCCTGAAGGCCCTCAACCT
CATCAACTCTCGACCCAACTGTGTCAATGTGTTGGTCACCACCACACAACTGATCCCTGCATTG
GCCAAGGTCCTGCTGTATGGTCTGGGCTCCGTGTTCCCCATCGAGAACATCTACAGCGCGACCA
AGACAGGCAAGGAGAGCTGCTTCGAGAGGATCATGCAGAGGTTCGGTCGCAAAGCTGTCTACAT
CGTGATAGGCGACGGGGTGGAGGAAGAGCAAGGAGCCAAAAAGCACAACATGCCGTTCTGGAGG
ATATCCTGCCACGCTGACCTGGAGGCTCTGAGGCATGCCCTGGAACTGGAGTATCTATAG

hide sequence

RefSeq Acc Id:

XM_039104163 ⟹ XP_038960091

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	174,818,475 - 174,938,035 (+)	NCBI
mRatBN7.2	3	154,399,171 - 154,519,006 (+)	NCBI

RefSeq Acc Id:

XM_039104164 ⟹ XP_038960092

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	174,818,475 - 174,938,035 (+)	NCBI
mRatBN7.2	3	154,399,172 - 154,519,006 (+)	NCBI

RefSeq Acc Id:

XM_039104165 ⟹ XP_038960093

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	174,829,065 - 174,938,035 (+)	NCBI
mRatBN7.2	3	154,409,789 - 154,519,006 (+)	NCBI

RefSeq Acc Id:

XM_063283024 ⟹ XP_063139094

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	174,754,772 - 174,883,018 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001417067	(Get FASTA)	NCBI Sequence Viewer
	NP_001417068	(Get FASTA)	NCBI Sequence Viewer
	NP_569111	(Get FASTA)	NCBI Sequence Viewer
	XP_038960091	(Get FASTA)	NCBI Sequence Viewer
	XP_038960092	(Get FASTA)	NCBI Sequence Viewer
	XP_038960093	(Get FASTA)	NCBI Sequence Viewer
	XP_063139094	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAQ72805	(Get FASTA)	NCBI Sequence Viewer
	BAB69960	(Get FASTA)	NCBI Sequence Viewer
	EDL96449	(Get FASTA)	NCBI Sequence Viewer
	EDL96450	(Get FASTA)	NCBI Sequence Viewer
	EDL96451	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000030502.6
	ENSRNOP00000071977
	ENSRNOP00000071977.3

RefSeq Acc Id:

NP_569111 ⟸ NM_130427

- UniProtKB:

Q6UN47 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLEVVISPSLAASSDWGEHGAAVGALTDREGTAKAASLSVPQLFAKSHPRVPPGQSSAAMAAYG
QTQYSTGIQQTPPYTAYPPPAQAYGIPPYSIKTEDSLNHSPSQSGFLSYGPSFSTAPAGQSPYT
YPVHSTAGLYQGANGLTNTAGFGSVHQDYPSYPNFPQNQYPQYFSPSYNPPYVPASSLCSSPLS
TSTYVLQEAPHNVSQSSESLAGDYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPVG
DNEIERVFVWDLDETIIIFHSLLTGTFASRYGKDTTTSVRIGLMMEEMIFNLADTHLFFNDLED
CDQIHVDDVSSDDNGQDLSTYNFSTDGFHSTAPGASLCLGTGVHGGVDWMRKLAFRYRRVKEMY
NTYRNNVGGLIGAPKRETWLQLRAELEALTDLWLTHSLKALNLINSRPNCVNVLVTTTQLIPAL
AKVLLYGLGSVFPIENIYSATKTGKESCFERIMQRFGRKAVYIVIGDGVEEEQGAKKHNMPFWR
ISCHADLEALRHALELEYL

hide sequence

Ensembl Acc Id:

ENSRNOP00000071977 ⟸ ENSRNOT00000087530

Ensembl Acc Id:

ENSRNOP00000030502 ⟸ ENSRNOT00000030119

RefSeq Acc Id:	XP_038960091 ⟸ XM_039104163
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038960092 ⟸ XM_039104164
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038960093 ⟸ XM_039104165
- Peptide Label:	isoform X3
- UniProtKB:	Q6UN47 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063139094 ⟸ XM_063283024
- Peptide Label:	isoform X4

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-E9PTJ3-F1-model_v2	AlphaFold	E9PTJ3	1-531	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620096	AgrOrtholog
BioCyc Gene	G2FUF-46794	BioCyc
Ensembl Genes	ENSRNOG00000019203	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000030119.6	UniProtKB/TrEMBL
	ENSRNOT00000087530	ENTREZGENE
	ENSRNOT00000087530.3	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.12350	UniProtKB/TrEMBL
InterPro	EYA	UniProtKB/TrEMBL
	EYA_dom_metazoan	UniProtKB/TrEMBL
	EYA_dom_sf	UniProtKB/TrEMBL
	EYA_fam	UniProtKB/TrEMBL
	HAD-like_sf	UniProtKB/TrEMBL
KEGG Report	rno:156826	UniProtKB/TrEMBL
NCBI Gene	156826	ENTREZGENE
PANTHER	PTHR10190	UniProtKB/TrEMBL
	PTHR10190:SF7	UniProtKB/TrEMBL
Pfam	Hydrolase	UniProtKB/TrEMBL
PhenoGen	Eya2	PhenoGen
RatGTEx	ENSRNOG00000019203	RatGTEx
Superfamily-SCOP	SSF56784	UniProtKB/TrEMBL
UniProt	A0A0G2K1T5_RAT	UniProtKB/TrEMBL
	A6JXF8_RAT	UniProtKB/TrEMBL
	A6JXF9_RAT	UniProtKB/TrEMBL
	A6JXG0_RAT	UniProtKB/TrEMBL
	E9PTJ3_RAT	UniProtKB/TrEMBL
	Q6UN47	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2014-06-25	Eya2	EYA transcriptional coactivator and phosphatase 2	Eya2	eyes absent homolog 2 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-09	Eya2	eyes absent homolog 2 (Drosophila)	Eya2	eyes absent 2 homolog (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Eya2	eyes absent 2 homolog (Drosophila)			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Eya2	eyes absent 2 homolog (Drosophila)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar