Advanced Search (OLGA)

Gene: Magt1 (magnesium transporter 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Magt1

Name:

magnesium transporter 1

RGD ID:

620094

Description:

Predicted to be involved in cognition and protein N-linked glycosylation via asparagine. Predicted to act upstream of or within magnesium ion transport. Predicted to be located in endoplasmic reticulum. Predicted to be part of oligosaccharyltransferase complex B. Human ortholog(s) of this gene implicated in X-linked immunodeficiency with magnesium defect, Epstein-Barr virus infection, and neoplasia and congenital disorder of glycosylation Icc. Orthologous to human MAGT1 (magnesium transporter 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit MAGT1; Iag2; IAP; implantation-associated protein; magnesium transporter protein 1; oligosaccharyl transferase subunit MAGT1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MAGT1 (magnesium transporter 1)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):	Magt1 (magnesium transporter 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Magt1 (magnesium transporter 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MAGT1 (magnesium transporter 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MAGT1 (magnesium transporter 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Magt1 (magnesium transporter 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MAGT1 (magnesium transporter 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MAGT1 (magnesium transporter 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Magt1 (magnesium transporter 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TUSC3 (tumor suppressor candidate 3)	HGNC	OrthoDB
Homo sapiens (human):	MFSD4B (major facilitator superfamily domain containing 4B)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	MAGT1 (magnesium transporter 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Magt1 (magnesium transporter 1)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	magt1 (magnesium transporter 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	OST3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Ostgamma	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ZK686.3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	OST6	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	magt1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	75,104,040 - 75,145,247 (-)	NCBI		GRCr8
mRatBN7.2	X	71,038,489 - 71,079,704 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	71,038,489 - 71,079,699 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	X	72,549,506 - 72,588,568 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	76,049,823 - 76,088,885 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	73,612,998 - 73,652,060 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	77,023,423 - 77,061,603 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	77,020,402 - 77,061,667 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	X	56,146,028 - 56,184,208 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	X	94,095,479 - 94,133,659 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	X	94,168,934 - 94,207,092 (-)	NCBI
Celera	X	72,353,918 - 72,392,096 (-)	NCBI		Celera
Cytogenetic Map	X	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Magt1	Rat	alpha thalassemia-X-linked intellectual disability syndrome		ISO	MAGT1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Alpha thalassemia-X-linked intellectual disability syndrome	ClinVar	PMID:11241493 more ...
Magt1	Rat	autistic disorder		ISO	MAGT1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autism	ClinVar	PMID:21681106 and PMID:30208311
Magt1	Rat	autosomal hemophilia A		ISO	MAGT1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: AUTOSOMAL HEMOPHILIA A	ClinVar	PMID:31690835
Magt1	Rat	congenital disorder of glycosylation		ISO	MAGT1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Congenital disorder of glycosylation	ClinVar	PMID:24550228 more ...
Magt1	Rat	congenital disorder of glycosylation Icc		ISO	MAGT1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Congenital disorder of glycosylation and type ICC	ClinVar	PMID:24550228 more ...
Magt1	Rat	Developmental Disease		ISO	MAGT1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Developmental disorder	ClinVar
Magt1	Rat	factor VIII deficiency		ISO	MAGT1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Factor 8 deficiency and congenital	ClinVar	PMID:31690835
Magt1	Rat	genetic disease		ISO	MAGT1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:25741868 and PMID:28492532
Magt1	Rat	Menkes disease		ISO	MAGT1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Menkes kinky-hair syndrome	ClinVar	PMID:11241493 more ...
Magt1	Rat	primary immunodeficiency disease		ISO	MAGT1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inherited Immunodeficiency Diseases	ClinVar	PMID:17576681 more ...
Magt1	Rat	syndromic X-linked intellectual disability Lubs type		ISO	MAGT1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Syndromic X-linked intellectual disability Lubs type	ClinVar	PMID:25741868
Magt1	Rat	X-linked immunodeficiency with magnesium defect, Epstein-Barr virus infection, and neoplasia		ISO	MAGT1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: X-linked immunodeficiency with magnesium defect and Epstein-Barr virus infection and neoplasia	ClinVar	PMID:16199547 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Magt1	Rat	primary immunodeficiency disease		ISS	Magt1 (Mus musculus)	13592920	OMIM:242850	MouseDO

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Magt1	Rat	congenital disorder of glycosylation Icc		ISO	MAGT1 (Homo sapiens)	7240710		OMIM
Magt1	Rat	X-linked immunodeficiency with magnesium defect, Epstein-Barr virus infection, and neoplasia		ISO	MAGT1 (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Magt1	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Magt1 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of MAGT1 mRNA	CTD	PMID:22206623
Magt1	Rat	17beta-estradiol	increases expression	ISO	Magt1 (Mus musculus)	6480464	Estradiol results in increased expression of MAGT1 mRNA	CTD	PMID:39298647
Magt1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of MAGT1 mRNA	CTD	PMID:32109520
Magt1	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2 and 4-dinitrotoluene affects the expression of MAGT1 mRNA	CTD	PMID:21346803
Magt1	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2 and 6-dinitrotoluene affects the expression of MAGT1 mRNA	CTD	PMID:21346803
Magt1	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	MAGT1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of MAGT1 mRNA more ...	CTD	PMID:28628672
Magt1	Rat	3H-1,2-dithiole-3-thione	decreases expression	EXP		6480464	1 and 2-dithiol-3-thione results in decreased expression of MAGT1 mRNA	CTD	PMID:19162173
Magt1	Rat	4,4'-sulfonyldiphenol	multiple interactions	ISO	MAGT1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of MAGT1 mRNA	CTD	PMID:28628672
Magt1	Rat	4,4'-sulfonyldiphenol	affects expression	ISO	MAGT1 (Homo sapiens)	6480464	bisphenol S affects the expression of MAGT1 protein	CTD	PMID:31945527
Magt1	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	Magt1 (Mus musculus)	6480464	bisphenol S results in increased expression of MAGT1 mRNA	CTD	PMID:39298647
Magt1	Rat	acetamide	decreases expression	EXP		6480464	acetamide results in decreased expression of MAGT1 mRNA	CTD	PMID:31881176
Magt1	Rat	aldehydo-D-glucose	decreases expression	ISO	Magt1 (Mus musculus)	6480464	Glucose results in decreased expression of MAGT1 mRNA	CTD	PMID:17178593
Magt1	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of MAGT1 mRNA	CTD	PMID:16483693
Magt1	Rat	benzo[a]pyrene	multiple interactions	ISO	Magt1 (Mus musculus)	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of MAGT1 mRNA	CTD	PMID:27858113
Magt1	Rat	benzo[a]pyrene	affects methylation	ISO	MAGT1 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of MAGT1 exon and Benzo(a)pyrene affects the methylation of MAGT1 promoter	CTD	PMID:27901495
Magt1	Rat	benzo[b]fluoranthene	decreases expression	ISO	Magt1 (Mus musculus)	6480464	benzo(b)fluoranthene results in decreased expression of MAGT1 mRNA	CTD	PMID:26377693
Magt1	Rat	benzo[b]fluoranthene	multiple interactions	ISO	Magt1 (Mus musculus)	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of MAGT1 mRNA	CTD	PMID:27858113
Magt1	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	Magt1 (Mus musculus)	6480464	Diethylhexyl Phthalate results in decreased expression of MAGT1 mRNA	CTD	PMID:34319233
Magt1	Rat	bisphenol A	increases expression	ISO	Magt1 (Mus musculus)	6480464	bisphenol A results in increased expression of MAGT1 mRNA	CTD	PMID:26063408
Magt1	Rat	bisphenol A	multiple interactions	ISO	MAGT1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of MAGT1 mRNA	CTD	PMID:28628672
Magt1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of MAGT1 mRNA	CTD	PMID:25181051 and PMID:33296240
Magt1	Rat	Bisphenol B	increases expression	ISO	MAGT1 (Homo sapiens)	6480464	bisphenol B results in increased expression of MAGT1 protein	CTD	PMID:34186270
Magt1	Rat	bisphenol F	multiple interactions	ISO	MAGT1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of MAGT1 mRNA	CTD	PMID:28628672
Magt1	Rat	bisphenol F	increases expression	ISO	MAGT1 (Homo sapiens)	6480464	bisphenol F results in increased expression of MAGT1 protein	CTD	PMID:34186270
Magt1	Rat	cadmium atom	multiple interactions	ISO	MAGT1 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of MAGT1 mRNA	CTD	PMID:35301059
Magt1	Rat	cadmium dichloride	multiple interactions	ISO	MAGT1 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of MAGT1 mRNA	CTD	PMID:35301059
Magt1	Rat	chlordecone	increases expression	ISO	Magt1 (Mus musculus)	6480464	Chlordecone results in increased expression of MAGT1 mRNA	CTD	PMID:33711761
Magt1	Rat	chrysene	multiple interactions	ISO	Magt1 (Mus musculus)	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of MAGT1 mRNA	CTD	PMID:27858113
Magt1	Rat	clofibrate	decreases expression	ISO	Magt1 (Mus musculus)	6480464	Clofibrate results in decreased expression of MAGT1 mRNA	CTD	PMID:23811191
Magt1	Rat	clozapine	multiple interactions	ISO	MAGT1 (Homo sapiens)	6480464	[Cuprizone co-treated with Clozapine] results in decreased expression of MAGT1 protein	CTD	PMID:34122009
Magt1	Rat	crocidolite asbestos	decreases expression	ISO	MAGT1 (Homo sapiens)	6480464	Asbestos and Crocidolite results in decreased expression of MAGT1 mRNA	CTD	PMID:29523930
Magt1	Rat	Cuprizon	multiple interactions	ISO	MAGT1 (Homo sapiens)	6480464	[Cuprizone co-treated with Clozapine] results in decreased expression of MAGT1 protein	CTD	PMID:34122009
Magt1	Rat	cyclosporin A	increases expression	ISO	MAGT1 (Homo sapiens)	6480464	Cyclosporine results in increased expression of MAGT1 mRNA	CTD	PMID:20106945
Magt1	Rat	cyproconazole	increases expression	ISO	Magt1 (Mus musculus)	6480464	cyproconazole results in increased expression of MAGT1 mRNA	CTD	PMID:22334560
Magt1	Rat	D-glucose	decreases expression	ISO	Magt1 (Mus musculus)	6480464	Glucose results in decreased expression of MAGT1 mRNA	CTD	PMID:17178593
Magt1	Rat	dexamethasone	multiple interactions	ISO	MAGT1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of MAGT1 mRNA more ...	CTD	PMID:28628672
Magt1	Rat	Dibutyl phosphate	affects expression	ISO	MAGT1 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of MAGT1 mRNA	CTD	PMID:37042841
Magt1	Rat	dicrotophos	decreases expression	ISO	MAGT1 (Homo sapiens)	6480464	dicrotophos results in decreased expression of MAGT1 mRNA	CTD	PMID:28302478
Magt1	Rat	diuron	decreases expression	EXP		6480464	Diuron results in decreased expression of MAGT1 mRNA	CTD	PMID:21551480
Magt1	Rat	doxorubicin	decreases expression	ISO	MAGT1 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of MAGT1 mRNA	CTD	PMID:29803840
Magt1	Rat	epoxiconazole	increases expression	ISO	Magt1 (Mus musculus)	6480464	epoxiconazole results in increased expression of MAGT1 mRNA	CTD	PMID:22334560
Magt1	Rat	ethanol	increases expression	ISO	Magt1 (Mus musculus)	6480464	Ethanol results in increased expression of MAGT1 mRNA	CTD	PMID:30319688
Magt1	Rat	ethanol	affects splicing	ISO	Magt1 (Mus musculus)	6480464	Ethanol affects the splicing of MAGT1 mRNA	CTD	PMID:30319688
Magt1	Rat	folic acid	decreases expression	ISO	Magt1 (Mus musculus)	6480464	Folic Acid results in decreased expression of MAGT1 mRNA	CTD	PMID:25629700
Magt1	Rat	furan	increases methylation	EXP		6480464	furan results in increased methylation of MAGT1 gene	CTD	PMID:22079235
Magt1	Rat	glucose	decreases expression	ISO	Magt1 (Mus musculus)	6480464	Glucose results in decreased expression of MAGT1 mRNA	CTD	PMID:17178593
Magt1	Rat	glycidyl methacrylate	decreases expression	ISO	MAGT1 (Homo sapiens)	6480464	glycidyl methacrylate results in decreased expression of MAGT1 protein	CTD	PMID:36641056
Magt1	Rat	indometacin	multiple interactions	ISO	MAGT1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of MAGT1 mRNA more ...	CTD	PMID:28628672
Magt1	Rat	ivermectin	decreases expression	ISO	MAGT1 (Homo sapiens)	6480464	Ivermectin results in decreased expression of MAGT1 protein	CTD	PMID:32959892
Magt1	Rat	methidathion	affects expression	ISO	Magt1 (Mus musculus)	6480464	methidathion affects the expression of MAGT1 mRNA	CTD	PMID:34813904
Magt1	Rat	monosodium L-glutamate	multiple interactions	ISO	Magt1 (Mus musculus)	6480464	[Trans Fatty Acids co-treated with Sodium Glutamate] results in increased expression of MAGT1 mRNA	CTD	PMID:22078008
Magt1	Rat	paracetamol	affects expression	ISO	Magt1 (Mus musculus)	6480464	Acetaminophen affects the expression of MAGT1 mRNA	CTD	PMID:17562736
Magt1	Rat	phenobarbital	affects expression	ISO	Magt1 (Mus musculus)	6480464	Phenobarbital affects the expression of MAGT1 mRNA	CTD	PMID:23091169
Magt1	Rat	pirinixic acid	multiple interactions	ISO	Magt1 (Mus musculus)	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of MAGT1 mRNA	CTD	PMID:19710929
Magt1	Rat	pirinixic acid	decreases expression	ISO	Magt1 (Mus musculus)	6480464	pirinixic acid results in decreased expression of MAGT1 mRNA	CTD	PMID:23811191
Magt1	Rat	propiconazole	increases expression	ISO	Magt1 (Mus musculus)	6480464	propiconazole results in increased expression of MAGT1 mRNA	CTD	PMID:22334560
Magt1	Rat	sodium arsenite	decreases expression	ISO	MAGT1 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of MAGT1 mRNA	CTD	PMID:28595984 and PMID:34032870
Magt1	Rat	temozolomide	decreases expression	ISO	MAGT1 (Homo sapiens)	6480464	Temozolomide results in decreased expression of MAGT1 mRNA	CTD	PMID:31758290
Magt1	Rat	tetraphene	decreases expression	ISO	Magt1 (Mus musculus)	6480464	benz(a)anthracene results in decreased expression of MAGT1 mRNA	CTD	PMID:26377693
Magt1	Rat	tetraphene	multiple interactions	ISO	Magt1 (Mus musculus)	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of MAGT1 mRNA	CTD	PMID:27858113
Magt1	Rat	titanium dioxide	increases methylation	ISO	Magt1 (Mus musculus)	6480464	titanium dioxide results in increased methylation of MAGT1 gene	CTD	PMID:35295148
Magt1	Rat	trichostatin A	affects expression	ISO	MAGT1 (Homo sapiens)	6480464	trichostatin A affects the expression of MAGT1 mRNA	CTD	PMID:28542535
Magt1	Rat	triphenyl phosphate	affects expression	ISO	MAGT1 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of MAGT1 mRNA	CTD	PMID:37042841
Magt1	Rat	undecane	decreases expression	EXP		6480464	undecane results in decreased expression of MAGT1 protein	CTD	PMID:17337753
Magt1	Rat	valproic acid	affects expression	ISO	Magt1 (Mus musculus)	6480464	Valproic Acid affects the expression of MAGT1 mRNA	CTD	PMID:17292431
Magt1	Rat	valproic acid	increases expression	ISO	MAGT1 (Homo sapiens)	6480464	Valproic Acid results in increased expression of MAGT1 mRNA	CTD	PMID:23179753 and PMID:27188386
Magt1	Rat	valproic acid	affects expression	ISO	MAGT1 (Homo sapiens)	6480464	Valproic Acid affects the expression of MAGT1 mRNA	CTD	PMID:25979313
Magt1	Rat	vinclozolin	affects expression	EXP		6480464	vinclozolin affects the expression of MAGT1 mRNA	CTD	PMID:19015723
Magt1	Rat	vincristine	decreases expression	ISO	MAGT1 (Homo sapiens)	6480464	Vincristine results in decreased expression of MAGT1 mRNA	CTD	PMID:23649840
Magt1	Rat	vorinostat	increases expression	ISO	MAGT1 (Homo sapiens)	6480464	vorinostat results in increased expression of MAGT1 mRNA	CTD	PMID:22083351
Magt1	Rat	zinc atom	increases expression	ISO	MAGT1 (Homo sapiens)	6480464	Zinc deficiency results in increased expression of MAGT1 mRNA	CTD	PMID:22171008
Magt1	Rat	zinc(0)	increases expression	ISO	MAGT1 (Homo sapiens)	6480464	Zinc deficiency results in increased expression of MAGT1 mRNA	CTD	PMID:22171008

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Magt1	Rat	cognition	involved_in	IEA	UniProtKB:Q9H0U3 and ensembl:ENSP00000480732	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Magt1	Rat	cognition	involved_in	ISO	MAGT1 (Homo sapiens)	1624291	PMID:18455129	RGD	PMID:18455129
Magt1	Rat	magnesium ion transport	acts_upstream_of_or_within	ISO	MAGT1 (Homo sapiens)	1624291	PMID:19717468	RGD	PMID:19717468
Magt1	Rat	magnesium ion transport	acts_upstream_of_or_within	IEA	UniProtKB:Q9H0U3 and ensembl:ENSP00000480732	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Magt1	Rat	protein glycosylation	involved_in	IEA	UniPathway:UPA00378	1600115	GO_REF:0000041	UniProt	GO_REF:0000041
Magt1	Rat	protein N-linked glycosylation	involved_in	ISO	MAGT1 (Homo sapiens)	1624291	PMID:31036665	RGD	PMID:31036665
Magt1	Rat	protein N-linked glycosylation	involved_in	IEA	UniProtKB:Q9H0U3 and ensembl:ENSP00000480732	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Magt1	Rat	protein N-linked glycosylation via asparagine	involved_in	IEA	UniProtKB:Q9H0U3 and ensembl:ENSP00000480732	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Magt1	Rat	protein N-linked glycosylation via asparagine	involved_in	IBA	PANTHER:PTN000294174 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Magt1	Rat	protein N-linked glycosylation via asparagine	involved_in	ISO	MAGT1 (Homo sapiens)	1624291	PMID:25135935	RGD	PMID:25135935

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Magt1	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB:Q9H0U3 and ensembl:ENSP00000480732	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Magt1	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB-SubCell:SL-0095	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Magt1	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB-KW:KW-0256	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Magt1	Rat	endoplasmic reticulum	located_in	ISO	MAGT1 (Homo sapiens)	1624291	PMID:25135935	RGD	PMID:25135935
Magt1	Rat	endoplasmic reticulum membrane	located_in	IEA	UniProtKB-SubCell:SL-0097	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Magt1	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Magt1	Rat	oligosaccharyltransferase complex	part_of	ISO	MAGT1 (Homo sapiens)	1624291	PMID:15835887 more ...	RGD	PMID:15835887 more ...
Magt1	Rat	oligosaccharyltransferase complex	part_of	IBA	PANTHER:PTN000294174 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Magt1	Rat	oligosaccharyltransferase complex	part_of	IEA	UniProtKB:Q9H0U3 and ensembl:ENSP00000480732	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Magt1	Rat	oligosaccharyltransferase complex	part_of	ISS	UniProtKB:Q9H0U3	1600115	GO_REF:0000024	HGNC-UCL	GO_REF:0000024
Magt1	Rat	oligosaccharyltransferase complex B	part_of	ISO	MAGT1 (Homo sapiens)	1624291	PMID:31831667	RGD	PMID:31831667
Magt1	Rat	oligosaccharyltransferase complex B	part_of	IEA	UniProtKB:Q9H0U3 and ensembl:ENSP00000480732	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Magt1	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Magt1	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:15835887	PMID:18455129	PMID:19717468	PMID:19946888	PMID:25135935	PMID:26358767	PMID:30704530	PMID:31036665

Magt1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	75,104,040 - 75,145,247 (-)	NCBI		GRCr8
mRatBN7.2	X	71,038,489 - 71,079,704 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	71,038,489 - 71,079,699 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	X	72,549,506 - 72,588,568 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	76,049,823 - 76,088,885 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	73,612,998 - 73,652,060 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	77,023,423 - 77,061,603 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	77,020,402 - 77,061,667 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	X	56,146,028 - 56,184,208 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	X	94,095,479 - 94,133,659 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	X	94,168,934 - 94,207,092 (-)	NCBI
Celera	X	72,353,918 - 72,392,096 (-)	NCBI		Celera
Cytogenetic Map	X	q22	NCBI

MAGT1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	X	77,825,747 - 77,895,568 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	X	77,825,747 - 77,899,271 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	X	77,081,244 - 77,151,065 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	X	76,968,517 - 77,037,583 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	X	76,888,006 - 76,957,072	NCBI
Celera	X	77,322,738 - 77,391,930 (-)	NCBI		Celera
Cytogenetic Map	X	q21.1	NCBI
HuRef	X	70,668,637 - 70,736,760 (-)	NCBI		HuRef
CHM1_1	X	76,974,589 - 77,043,753 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	X	76,263,304 - 76,330,626 (-)	NCBI		T2T-CHM13v2.0

Magt1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	X	105,011,690 - 105,055,408 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	X	105,011,690 - 105,055,512 (-)	Ensembl		GRCm39 Ensembl
GRCm38	X	105,968,084 - 106,011,802 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	X	105,968,084 - 106,011,906 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	X	103,163,423 - 103,207,238 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	X	102,172,936 - 102,214,495 (-)	NCBI		MGSCv36	mm8
Celera	X	92,821,884 - 92,865,614 (-)	NCBI		Celera
Cytogenetic Map	X	D	NCBI
cM Map	X	47.36	NCBI

Magt1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955557	1,290,615 - 1,336,198 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955557	1,294,408 - 1,336,164 (-)	NCBI	ChiLan1.0	ChiLan1.0

MAGT1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	X	77,408,743 - 77,477,831 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	X	77,412,354 - 77,481,442 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	X	67,009,590 - 67,078,691 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	X	77,122,801 - 77,190,690 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	X	77,122,801 - 77,190,690 (-)	Ensembl	panpan1.1		panPan2

MAGT1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	X	60,122,021 - 60,186,457 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	X	60,128,571 - 60,186,507 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	X	51,135,133 - 51,199,577 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	X	61,360,509 - 61,425,186 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	X	61,365,458 - 61,425,243 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	X	59,066,835 - 59,130,908 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	X	60,676,273 - 60,741,764 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	X	60,264,710 - 60,329,424 (-)	NCBI		UU_Cfam_GSD_1.0

Magt1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	X	42,172,097 - 42,212,171 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936683	2,735,217 - 2,775,679 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936683	2,737,545 - 2,775,679 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MAGT1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	X	61,894,965 - 61,958,517 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	X	61,894,237 - 61,958,511 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	X	70,812,442 - 70,877,270 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MAGT1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	X	66,798,408 - 66,829,249 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	X	66,797,359 - 66,829,263 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666067	14,678,349 - 14,732,000 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Magt1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624836	3,077,425 - 3,144,004 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624836	3,076,940 - 3,144,004 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Magt1
91 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	19
Count of miRNA genes:	19
Interacting mature miRNAs:	19
Transcripts:	ENSRNOT00000068479
Prediction methods:	Miranda, Pita, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61430	Cia18	Collagen induced arthritis QTL 18	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	X	14843113	120568734	Rat
61431	Cia19	Collagen induced arthritis QTL 19	4.4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	X	65612192	120568734	Rat
738035	Stresp1	Stress response QTL 1	4.96	0.000011	stress-related behavior trait (VT:0010451)	defensive burying - coping	X	41304447	112935181	Rat
1598837	Memor13	Memory QTL 13	3.2		exploratory behavior trait (VT:0010471)	difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678)	X	41052407	146860749	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_053946	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039099413	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063279756	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC130061	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF008554	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000081671 ⟹ ENSRNOP00000072000

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	X	71,045,671 - 71,079,676 (-)	Ensembl
Rnor_6.0 Ensembl	X	77,038,394 - 77,061,593 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000083643 ⟹ ENSRNOP00000075434

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	X	71,040,636 - 71,079,699 (-)	Ensembl
Rnor_6.0 Ensembl	X	77,020,431 - 77,061,604 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000089386 ⟹ ENSRNOP00000073419

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	X	71,038,489 - 71,079,638 (-)	Ensembl
Rnor_6.0 Ensembl	X	77,020,402 - 77,061,667 (-)	Ensembl

RefSeq Acc Id:

NM_053946 ⟹ NP_446398

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	75,106,154 - 75,145,212 (-)	NCBI
mRatBN7.2	X	71,040,604 - 71,079,662 (-)	NCBI
Rnor_6.0	X	77,023,423 - 77,061,603 (-)	NCBI
Rnor_5.0	X	56,146,028 - 56,184,208 (-)	NCBI
RGSC_v3.4	X	94,095,479 - 94,133,659 (-)	RGD
Celera	X	72,353,918 - 72,392,096 (-)	NCBI

Sequence:

show sequence

AATTGAGGAGGTCAGAAGGTTTCGCCCGGTCGCCGAGAGAGACAAGCGAACATGGCCTCGCCGAGGTGGCTCTGGTGTGTGTGTGCGACCGCAGCGGTCACACTGCTGCTCGTTTCCAAGGTTCCTTC
GGCCTCTGCCCAAAGAAAGAAGGAGAAGGTTTTAGTGGAGAAGGTCATTCAGCTGATGGAATGGACCAATCAAAGACCAGTCATAAGAATGAATGGAGACAAGTTCCGTCCCCTTGTTAAAGCACCAC
CAAGAAATTACTCTGTTATTGTCATGTTTACTGCTCTCCAACTTCATAGACAATGTGTCGTTTGCAAGCAAGCTGATGAAGAATTCCAGATTTTGGCAAATTTTTGGCGATACTCCAGTGCATTTACC
AACCGCATATTTTTTGCCATGGTGGATTTTGATGAAGGCTCTGATGTATTTCAAATGCTAAACATGAATTCAGCTCCAACTTTCATCAACTTTCCTCCAAAAGGAAAACCCAAAAGGGCTGATACATA
TGAGTTGCAGGTGCGAGGGTTTTCAGCTGAACAGATTGCCCGGTGGATCGCAGACAGAACTGACGTCAACATTAGAGTAATCAGACCTCCAAATTATGCTGGACCTCTAATGTTGGGGTTGCTTCTTG
CTGTTATTGGTGGACTTGTGTATCTGCGACGAAGTAATATGGAATTCCTCTTTAATAAAACCGGATGGGCTTTTGCAGCATTGTGTTTTGTACTTGCAATGACATCTGGCCAAATGTGGAACCATATA
AGAGGACCACCATATGCTCATAAGAATCCCCATACAGGACATGTGAATTATATCCACGGAAGCAGCCAAGCACAGTTTGTAGCTGAAACCCACATTGTTCTTCTCTTCAATGGTGGGGTTACCTTAGG
TATGGTGCTTTTATGTGAAGCTGCTGCCTCTGACATGGATATTGGGAAGCGAAGGATGATGTGTATTGCTGGGATTGGACTTGTTGTGTTATTCTTCAGTTGGATGCTGTCCATCTTTCGATCAAAAT
ACCATGGCTATCCATACAGCTTTCTGATGAGTTAAAGAGGATTCCAGAGAAACATTGACACCGGTAATGGAAACTGAAAAATAAAACCTGTTGGGGGTTGGAGAATGCACTCAAGTTTTTTCTTACCC
CTTGGGCAAGGAACGACTTATAACAATTACCAAGTCCGGGGCCTTAAAGAAAGGAACAGAGGTTTGG

hide sequence

RefSeq Acc Id:

XM_039099413 ⟹ XP_038955341

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	75,104,040 - 75,145,247 (-)	NCBI
mRatBN7.2	X	71,038,489 - 71,079,704 (-)	NCBI

RefSeq Acc Id:

XM_063279756 ⟹ XP_063135826

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	75,104,040 - 75,145,212 (-)	NCBI


Protein RefSeqs	NP_446398	(Get FASTA)	NCBI Sequence Viewer
	XP_038955341	(Get FASTA)	NCBI Sequence Viewer
	XP_063135826	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB63294	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000073419
	ENSRNOP00000075434
GenBank Protein	O35777	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_446398 ⟸ NM_053946
- Peptide Label:	precursor
- UniProtKB:	O35777 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MASPRWLWCVCATAAVTLLLVSKVPSASAQRKKEKVLVEKVIQLMEWTNQRPVIRMNGDKFRPLVKAPPRNYSVIVMFTALQLHRQCVVCKQADEEFQILANFWRYSSAFTNRIFFAMVDFDEGSDVF QMLNMNSAPTFINFPPKGKPKRADTYELQVRGFSAEQIARWIADRTDVNIRVIRPPNYAGPLMLGLLLAVIGGLVYLRRSNMEFLFNKTGWAFAALCFVLAMTSGQMWNHIRGPPYAHKNPHTGHVNY IHGSSQAQFVAETHIVLLFNGGVTLGMVLLCEAAASDMDIGKRRMMCIAGIGLVVLFFSWMLSIFRSKYHGYPYSFLMS hide sequence

Ensembl Acc Id:

ENSRNOP00000073419 ⟸ ENSRNOT00000089386

Ensembl Acc Id:

ENSRNOP00000072000 ⟸ ENSRNOT00000081671

Ensembl Acc Id:

ENSRNOP00000075434 ⟸ ENSRNOT00000083643

RefSeq Acc Id:	XP_038955341 ⟸ XM_039099413
- Peptide Label:	isoform X1
- UniProtKB:	O35777 (UniProtKB/Swiss-Prot)

Protein Domains

Thioredoxin

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O35777-F1-model_v2	AlphaFold	O35777	1-335	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13701900

Promoter ID:

EPDNEW_R12422

Type:

initiation region

Name:

Magt1_1

Description:

magnesium transporter 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	X	77,061,604 - 77,061,664	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-1928	BioCyc
Ensembl Genes	ENSRNOG00000051408	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000083643	ENTREZGENE
	ENSRNOT00000089386	ENTREZGENE
Gene3D-CATH	Glutaredoxin	UniProtKB/Swiss-Prot
InterPro	OligosaccharylTrfase_OST3/OST6	UniProtKB/Swiss-Prot
	Thioredoxin-like_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:116967	UniProtKB/Swiss-Prot
NCBI Gene	116967	ENTREZGENE
PANTHER	PTHR12692	UniProtKB/Swiss-Prot
	PTHR12692:SF2	UniProtKB/Swiss-Prot
Pfam	OST3_OST6	UniProtKB/Swiss-Prot
PhenoGen	Magt1	PhenoGen
RatGTEx	ENSRNOG00000051408	RatGTEx
Superfamily-SCOP	SSF52833	UniProtKB/Swiss-Prot
UniProt	A0A096MJ31_RAT	UniProtKB/TrEMBL
	A0A0G2K5G6_RAT	UniProtKB/TrEMBL
	G3V9X8	ENTREZGENE, UniProtKB/TrEMBL
	MAGT1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-22	Magt1	magnesium transporter 1	Iag2	implantation-associated protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Iag2	implantation-associated protein	IAG2		Symbol updated	1299863	APPROVED
2002-08-07	IAG2	implantation-associated protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM