Symbol:
Pomt1
Name:
protein-O-mannosyltransferase 1
RGD ID:
620078
Description:
Predicted to enable mannosyltransferase activity. Involved in positive regulation of protein O-linked glycosylation. Predicted to be located in acrosomal vesicle; endoplasmic reticulum membrane; and sarcoplasmic reticulum. Predicted to be part of dolichyl-phosphate-mannose-protein mannosyltransferase complex. Human ortholog(s) of this gene implicated in cardiomyopathy; cleft lip; lissencephaly; and muscular dystrophy (multiple). Orthologous to human POMT1 (protein O-mannosyltransferase 1); PARTICIPATES IN O-linked glycan biosynthetic pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3,3',5-triiodo-L-thyronine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
dolichyl-phosphate-mannose--protein mannosyltransferase 1; protein O-mannosyl-transferase 1; protein O-mannosyltransferase 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 35,918,370 - 35,936,330 (+) NCBI GRCr8 mRatBN7.2 3 15,520,717 - 15,538,579 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 15,520,481 - 15,538,581 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 18,590,099 - 18,607,991 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 27,175,092 - 27,192,984 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 25,425,586 - 25,443,460 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 11,253,424 - 11,271,873 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 11,254,026 - 11,271,872 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 16,602,808 - 16,620,746 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 11,348,786 - 11,366,633 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 11,245,184 - 11,263,006 (+) NCBI Celera 3 10,265,600 - 10,283,445 (+) NCBI Celera Cytogenetic Map 3 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pomt1 Rat (1->4)-beta-D-glucan multiple interactions ISO Pomt1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of POMT1 mRNA CTD PMID:36331819 Pomt1 Rat 1,2-dimethylhydrazine increases expression ISO Pomt1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of POMT1 mRNA CTD PMID:22206623 Pomt1 Rat 17alpha-ethynylestradiol multiple interactions ISO Pomt1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of POMT1 mRNA CTD PMID:17942748 Pomt1 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of POMT1 mRNA CTD PMID:26496021 Pomt1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Pomt1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of POMT1 mRNA CTD PMID:17942748 Pomt1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of POMT1 mRNA CTD PMID:33387578 Pomt1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Pomt1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of POMT1 mRNA CTD PMID:21570461 Pomt1 Rat 2-methylcholine affects expression ISO POMT1 (Homo sapiens) 6480464 beta-methylcholine affects the expression of POMT1 mRNA CTD PMID:21179406 Pomt1 Rat 3,3',5-triiodo-L-thyronine increases expression EXP 6480464 Triiodothyronine results in increased expression of POMT1 mRNA CTD PMID:15953391 Pomt1 Rat 4,4'-diaminodiphenylmethane increases expression ISO Pomt1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of POMT1 mRNA CTD PMID:18648102 Pomt1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Pomt1 (Mus musculus) 6480464 bisphenol S results in decreased expression of POMT1 mRNA CTD PMID:39298647 Pomt1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of POMT1 mRNA CTD PMID:36843608 Pomt1 Rat acrolein multiple interactions ISO POMT1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of and results in increased oxidation of POMT1 mRNA more ... CTD PMID:32699268 and PMID:32845096 Pomt1 Rat actinomycin D increases expression ISO POMT1 (Homo sapiens) 6480464 Dactinomycin results in increased expression of POMT1 mRNA CTD PMID:21527772 Pomt1 Rat alpha-pinene multiple interactions ISO POMT1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of and results in increased oxidation of POMT1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of and results in increased oxidation of POMT1 mRNA CTD PMID:32699268 Pomt1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of POMT1 mRNA CTD PMID:16483693 Pomt1 Rat antirheumatic drug increases expression ISO POMT1 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of POMT1 mRNA CTD PMID:24449571 Pomt1 Rat arsane multiple interactions ISO POMT1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of POMT1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of POMT1 mRNA CTD PMID:39836092 Pomt1 Rat arsenic atom multiple interactions ISO POMT1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of POMT1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of POMT1 mRNA CTD PMID:39836092 Pomt1 Rat arsenous acid decreases expression ISO POMT1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of POMT1 mRNA CTD PMID:20458559 Pomt1 Rat benzo[a]pyrene decreases expression ISO Pomt1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of POMT1 mRNA CTD PMID:22228805 Pomt1 Rat benzo[a]pyrene increases methylation ISO POMT1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of POMT1 5' UTR and Benzo(a)pyrene results in increased methylation of POMT1 promoter CTD PMID:27901495 Pomt1 Rat beta-lapachone increases expression ISO POMT1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of POMT1 mRNA CTD PMID:38218311 Pomt1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Pomt1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of POMT1 mRNA CTD PMID:34319233 Pomt1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of POMT1 mRNA CTD PMID:26496021 Pomt1 Rat bisphenol A decreases expression ISO Pomt1 (Mus musculus) 6480464 bisphenol A results in decreased expression of POMT1 mRNA CTD PMID:32156529 Pomt1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of POMT1 mRNA CTD PMID:30816183 and PMID:32528016 Pomt1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of POMT1 mRNA CTD PMID:25181051 Pomt1 Rat carbon nanotube decreases expression ISO Pomt1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Pomt1 Rat CGP 52608 multiple interactions ISO POMT1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to POMT1 gene] CTD PMID:28238834 Pomt1 Rat copper(II) sulfate decreases expression ISO POMT1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of POMT1 mRNA CTD PMID:19549813 Pomt1 Rat diarsenic trioxide decreases expression ISO POMT1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of POMT1 mRNA CTD PMID:20458559 Pomt1 Rat epoxiconazole decreases expression ISO Pomt1 (Mus musculus) 6480464 epoxiconazole results in decreased expression of POMT1 mRNA CTD PMID:35436446 Pomt1 Rat ferroheme b decreases expression ISO Pomt1 (Mus musculus) 6480464 Heme metabolite results in decreased expression of POMT1 mRNA CTD PMID:19191707 Pomt1 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of POMT1 mRNA CTD PMID:24136188 Pomt1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of POMT1 mRNA CTD PMID:24136188 Pomt1 Rat folic acid decreases expression ISO Pomt1 (Mus musculus) 6480464 Folic Acid results in decreased expression of POMT1 mRNA CTD PMID:25629700 Pomt1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of POMT1 mRNA CTD PMID:22061828 Pomt1 Rat heme b decreases expression ISO Pomt1 (Mus musculus) 6480464 Heme metabolite results in decreased expression of POMT1 mRNA CTD PMID:19191707 Pomt1 Rat manganese atom multiple interactions ISO POMT1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of POMT1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of POMT1 mRNA CTD PMID:39836092 Pomt1 Rat manganese(0) multiple interactions ISO POMT1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of POMT1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of POMT1 mRNA CTD PMID:39836092 Pomt1 Rat manganese(II) chloride multiple interactions ISO POMT1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of POMT1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of POMT1 mRNA CTD PMID:39836092 Pomt1 Rat N-ethyl-N-nitrosourea increases mutagenesis EXP 6480464 Ethylnitrosourea results in increased mutagenesis of POMT1 gene CTD PMID:16495775 Pomt1 Rat ozone multiple interactions ISO POMT1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of and results in increased oxidation of POMT1 mRNA more ... CTD PMID:32699268 and PMID:32845096 Pomt1 Rat paracetamol affects expression ISO Pomt1 (Mus musculus) 6480464 Acetaminophen affects the expression of POMT1 mRNA CTD PMID:17562736 Pomt1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of POMT1 mRNA CTD PMID:33387578 Pomt1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Pomt1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of POMT1 mRNA CTD PMID:36331819 Pomt1 Rat pirinixic acid increases expression ISO Pomt1 (Mus musculus) 6480464 pirinixic acid results in increased expression of POMT1 mRNA CTD PMID:18301758 and PMID:23811191 Pomt1 Rat simvastatin increases expression ISO Pomt1 (Mus musculus) 6480464 Simvastatin results in increased expression of POMT1 mRNA CTD PMID:19262002 Pomt1 Rat sodium arsenite multiple interactions ISO POMT1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of POMT1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of POMT1 mRNA CTD PMID:39836092 Pomt1 Rat Soman increases expression EXP 6480464 Soman results in increased expression of POMT1 mRNA CTD PMID:19281266 Pomt1 Rat temozolomide increases expression ISO POMT1 (Homo sapiens) 6480464 Temozolomide results in increased expression of POMT1 mRNA CTD PMID:31758290 Pomt1 Rat titanium dioxide increases expression ISO Pomt1 (Mus musculus) 6480464 titanium dioxide results in increased expression of POMT1 mRNA CTD PMID:23557971 Pomt1 Rat titanium dioxide decreases methylation ISO Pomt1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of POMT1 gene and titanium dioxide results in decreased methylation of POMT1 promoter CTD PMID:35295148 Pomt1 Rat trovafloxacin decreases expression ISO Pomt1 (Mus musculus) 6480464 trovafloxacin results in decreased expression of POMT1 mRNA CTD PMID:35537566 Pomt1 Rat valproic acid affects expression ISO Pomt1 (Mus musculus) 6480464 Valproic Acid affects the expression of POMT1 mRNA CTD PMID:17292431 Pomt1 Rat valproic acid decreases expression ISO POMT1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of POMT1 mRNA CTD PMID:28001369 Pomt1 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of POMT1 mRNA CTD PMID:23555832
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-methylcholine (ISO) 3,3',5-triiodo-L-thyronine (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acrolein (ISO) actinomycin D (ISO) alpha-pinene (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) carbon nanotube (ISO) CGP 52608 (ISO) copper(II) sulfate (ISO) diarsenic trioxide (ISO) epoxiconazole (ISO) ferroheme b (ISO) finasteride (EXP) flutamide (EXP) folic acid (ISO) gentamycin (EXP) heme b (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) N-ethyl-N-nitrosourea (EXP) ozone (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) pirinixic acid (ISO) simvastatin (ISO) sodium arsenite (ISO) Soman (EXP) temozolomide (ISO) titanium dioxide (ISO) trovafloxacin (ISO) valproic acid (ISO) vinclozolin (EXP)
1.
Cardiomyopathy in patients with POMT1-related congenital and limb-girdle muscular dystrophy.
Bello L, etal., Eur J Hum Genet. 2012 Dec;20(12):1234-9. doi: 10.1038/ejhg.2012.71. Epub 2012 May 2.
2.
Mutations in the O-mannosyltransferase gene POMT1 give rise to the severe neuronal migration disorder Walker-Warburg syndrome.
Beltran-Valero de Bernabe D, etal., Am J Hum Genet 2002 Nov;71(5):1033-43.
3.
Molecular heterogeneity in fetal forms of type II lissencephaly.
Bouchet C, etal., Hum Mutat. 2007 Oct;28(10):1020-7.
4.
Mutations in POMT1 are found in a minority of patients with Walker-Warburg syndrome.
Currier SC, etal., Am J Med Genet A. 2005 Feb 15;133A(1):53-7.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
7.
Identification of a human homolog of the Drosophila rotated abdomen gene (POMT1) encoding a putative protein O-mannosyl-transferase, and assignment to human chromosome 9q34.1.
Jurado LA, etal., Genomics 1999 Jun 1;58(2):171-80.
8.
Molecular cloning and characterization of rat Pomt1 and Pomt2.
Manya H, etal., Glycobiology. 2006 Sep;16(9):863-73. Epub 2006 May 16.
9.
Demonstration of mammalian protein O-mannosyltransferase activity: coexpression of POMT1 and POMT2 required for enzymatic activity.
Manya H, etal., Proc Natl Acad Sci U S A 2004 Jan 13;101(2):500-5. Epub 2003 Dec 29.
10.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
11.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
13.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
14.
GOA pipeline
RGD automated data pipeline
15.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
17.
Comprehensive gene review and curation
RGD comprehensive gene curation
18.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
19.
Walker-Warburg Syndrome with POMT1 mutations can be associated with cleft lip and cleft palate.
Vajsar J, etal., Neuromuscul Disord. 2008 Aug;18(8):675-7. doi: 10.1016/j.nmd.2008.05.014. Epub 2008 Jul 18.
20.
The expanding phenotype of POMT1 mutations: from Walker-Warburg syndrome to congenital muscular dystrophy, microcephaly, and mental retardation.
van Reeuwijk J, etal., Hum Mutat. 2006 May;27(5):453-9.
Pomt1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 35,918,370 - 35,936,330 (+) NCBI GRCr8 mRatBN7.2 3 15,520,717 - 15,538,579 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 15,520,481 - 15,538,581 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 18,590,099 - 18,607,991 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 27,175,092 - 27,192,984 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 25,425,586 - 25,443,460 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 11,253,424 - 11,271,873 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 11,254,026 - 11,271,872 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 16,602,808 - 16,620,746 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 11,348,786 - 11,366,633 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 11,245,184 - 11,263,006 (+) NCBI Celera 3 10,265,600 - 10,283,445 (+) NCBI Celera Cytogenetic Map 3 p12 NCBI
POMT1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 131,502,918 - 131,523,799 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 131,502,789 - 131,523,806 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 134,378,305 - 134,399,186 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 133,368,110 - 133,389,014 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 131,407,865 - 131,428,746 NCBI Celera 9 104,918,461 - 104,939,373 (+) NCBI Celera Cytogenetic Map 9 q34.13 NCBI HuRef 9 103,872,837 - 103,893,810 (+) NCBI HuRef CHM1_1 9 134,527,759 - 134,548,591 (+) NCBI CHM1_1 T2T-CHM13v2.0 9 143,715,812 - 143,736,761 (+) NCBI T2T-CHM13v2.0
Pomt1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 32,126,321 - 32,145,017 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 32,126,602 - 32,145,017 (+) Ensembl GRCm39 Ensembl GRCm38 2 32,236,590 - 32,255,005 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 32,236,590 - 32,255,005 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 32,092,203 - 32,110,525 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 32,058,692 - 32,077,014 (+) NCBI MGSCv36 mm8 Celera 2 31,941,009 - 31,959,335 (+) NCBI Celera Cytogenetic Map 2 B NCBI cM Map 2 22.09 NCBI
Pomt1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955513 1,189,169 - 1,203,933 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955513 1,189,169 - 1,203,933 (+) NCBI ChiLan1.0 ChiLan1.0
POMT1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 7,830,942 - 7,854,814 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 7,833,278 - 7,857,624 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 102,625,290 - 102,646,066 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 131,265,750 - 131,285,881 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 131,265,750 - 131,285,881 (+) Ensembl panpan1.1 panPan2
POMT1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 52,615,349 - 52,631,538 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 52,615,655 - 52,630,836 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 51,882,359 - 51,899,815 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 53,517,596 - 53,535,056 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 53,519,165 - 53,535,048 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 52,297,027 - 52,312,897 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 52,614,407 - 52,631,871 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 52,708,808 - 52,726,275 (-) NCBI UU_Cfam_GSD_1.0
Pomt1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 198,481,216 - 198,499,348 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936487 18,249,472 - 18,267,256 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936487 18,249,472 - 18,267,875 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
POMT1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 271,432,210 - 271,452,461 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 271,432,196 - 271,448,584 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 305,440,591 - 305,456,740 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
POMT1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 6,620,179 - 6,639,051 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 6,618,312 - 6,639,024 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666079 8,918,116 - 8,938,223 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pomt1
.
Predicted Target Of
Count of predictions: 91 Count of miRNA genes: 67 Interacting mature miRNAs: 83 Transcripts: ENSRNOT00000015214 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1358357 Srcrtb1 Stress Responsive Cort Basal QTL 1 6.36 0.002 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 8658162 27494778 Rat 6893355 Bw101 Body weight QTL 101 0.4 0.38 body mass (VT:0001259) body weight (CMO:0000012) 3 10778704 30357018 Rat 10401810 Kidm53 Kidney mass QTL 53 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 8227194 47233430 Rat 1298526 Arunc3 Aerobic running capacity QTL 3 2.2 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 3 8227194 33703538 Rat 8693641 Alc30 Alcohol consumption QTL 30 2 0.739 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 3 10434306 24512004 Rat 2298542 Neuinf11 Neuroinflammation QTL 11 3.9 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 3 15005422 76927699 Rat 1558657 Cm43 Cardiac mass QTL 43 6.6 3e-08 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 10778823 30356773 Rat 631568 Bp92 Blood pressure QTL 92 2.2 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 1 39874793 Rat 6893363 Bw105 Body weight QTL 105 2.6 0.0036 body mass (VT:0001259) body weight (CMO:0000012) 3 10778704 30357018 Rat 61468 Bp15 Blood pressure QTL 15 4.4 blood pressure trait (VT:0000183) pulse pressure (CMO:0000292) 3 1 33278763 Rat 631831 Alc8 Alcohol consumption QTL 8 2.7 consumption behavior trait (VT:0002069) calculated ethanol drink intake rate (CMO:0001615) 3 1 33230976 Rat 1558647 Cm46 Cardiac mass QTL 46 5.4 0.0000055 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 10778823 30356773 Rat 4889966 Bss95 Bone structure and strength QTL 95 4.4 tibia area (VT:1000281) tibia-fibula cross-sectional area (CMO:0001718) 3 1 36847613 Rat 1558654 Bw56 Body weight QTL 56 4.5 0.0000171 body mass (VT:0001259) body weight (CMO:0000012) 3 10778704 30357018 Rat 1558650 Cm48 Cardiac mass QTL 48 4 0.0001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 3 10778823 30356773 Rat 1358905 Hrtrt17 Heart rate QTL 17 5.9 0.000014 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 10861912 89878372 Rat 70191 BpQTLcluster4 Blood pressure QTL cluster 4 3 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 3 10778704 50302886 Rat 631545 Bp85 Blood pressure QTL 85 3.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 1 33278763 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 631679 Cm10 Cardiac mass QTL 10 7.34 0.0001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 1 31158234 Rat 2290452 Scl56 Serum cholesterol level QTL 56 2.26 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 3 1 91609953 Rat 70203 Gcr2 Gastric cancer resistance QTL 2 2.6 stomach morphology trait (VT:0000470) stomach tumor susceptibility score (CMO:0002043) 3 8658162 27494778 Rat 70202 Alc19 Alcohol consumption QTL 19 2.5 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 3 1 27494778 Rat 2312664 Scl62 Serum cholesterol level QTL 62 0.05 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 1 38710544 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat
RH130122
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 15,538,647 - 15,538,834 (+) MAPPER mRatBN7.2 Rnor_6.0 3 11,271,942 - 11,272,128 NCBI Rnor6.0 Rnor_5.0 3 16,620,812 - 16,620,998 UniSTS Rnor5.0 RGSC_v3.4 3 11,366,702 - 11,366,888 UniSTS RGSC3.4 Celera 3 10,283,514 - 10,283,700 UniSTS RH 3.4 Map 3 65.7 UniSTS Cytogenetic Map 3 p11 UniSTS
RH131674
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 15,538,229 - 15,538,438 (+) MAPPER mRatBN7.2 Rnor_6.0 3 11,271,524 - 11,271,732 NCBI Rnor6.0 Rnor_5.0 3 16,620,394 - 16,620,602 UniSTS Rnor5.0 RGSC_v3.4 3 11,366,284 - 11,366,492 UniSTS RGSC3.4 Celera 3 10,283,096 - 10,283,304 UniSTS RH 3.4 Map 3 65.8 UniSTS Cytogenetic Map 3 p11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000015214 ⟹ ENSRNOP00000015214
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 15,520,481 - 15,538,581 (+) Ensembl Rnor_6.0 Ensembl 3 11,254,026 - 11,271,872 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000082794 ⟹ ENSRNOP00000073262
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 15,520,762 - 15,538,578 (+) Ensembl Rnor_6.0 Ensembl 3 11,254,056 - 11,271,872 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000119777 ⟹ ENSRNOP00000079634
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 15,520,762 - 15,538,578 (+) Ensembl
RefSeq Acc Id:
NM_053406 ⟹ NP_445858
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 35,918,480 - 35,936,327 (+) NCBI mRatBN7.2 3 15,520,732 - 15,538,579 (+) NCBI Rnor_6.0 3 11,254,026 - 11,271,873 (+) NCBI Rnor_5.0 3 16,602,808 - 16,620,746 (+) NCBI RGSC_v3.4 3 11,348,786 - 11,366,633 (+) RGD Celera 3 10,265,600 - 10,283,445 (+) RGD
Sequence:
CGAAAAATTAGTTGGGCGCTCCGGAGTAATCGAGCAGCCTCTCCCCCAACGGTCGAACCAGCTTGGCGGGTTGCAGGCCTGGCTCCACATGGGGAACCGCTCAATGGGACGCGAAGATACGCTTGGTG
hide sequence
RefSeq Acc Id:
XM_039105979 ⟹ XP_038961907
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 35,918,380 - 35,936,330 (+) NCBI mRatBN7.2 3 15,520,820 - 15,538,579 (+) NCBI
RefSeq Acc Id:
XM_063284710 ⟹ XP_063140780
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 35,918,370 - 35,934,169 (+) NCBI
RefSeq Acc Id:
XR_005501994
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 35,918,373 - 35,935,164 (+) NCBI mRatBN7.2 3 15,520,717 - 15,537,416 (+) NCBI
RefSeq Acc Id:
NP_445858 ⟸ NM_053406
- UniProtKB:
Q6IRI2 (UniProtKB/Swiss-Prot), Q99PR0 (UniProtKB/Swiss-Prot), A6JU44 (UniProtKB/TrEMBL), A0A0G2K523 (UniProtKB/TrEMBL)
- Sequence:
MGNRSMGREDTLGVLPSLLFCKMLRFLKRPLVVTIDINLNLVALTVLGLLTRLWQLSYPRAVVFDEVYYGQYISFYMKRVFFLDDSGPPFGHMLLALGGWLGGFDGNFLWNRIGAEYSSNVPVWSLRL
hide sequence
Ensembl Acc Id:
ENSRNOP00000073262 ⟸ ENSRNOT00000082794
Ensembl Acc Id:
ENSRNOP00000015214 ⟸ ENSRNOT00000015214
RefSeq Acc Id:
XP_038961907 ⟸ XM_039105979
- Peptide Label:
isoform X1
- UniProtKB:
Q99PR0 (UniProtKB/Swiss-Prot), Q6IRI2 (UniProtKB/Swiss-Prot), A6JU44 (UniProtKB/TrEMBL), A0A0G2K523 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000079634 ⟸ ENSRNOT00000119777
RefSeq Acc Id:
XP_063140780 ⟸ XM_063284710
- Peptide Label:
isoform X2
- UniProtKB:
A0A0G2K523 (UniProtKB/TrEMBL)
RGD ID: 13691988 Promoter ID: EPDNEW_R2503 Type: initiation region Name: Pomt1_1 Description: protein-O-mannosyltransferase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 11,254,061 - 11,254,121 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Pomt1
protein-O-mannosyltransferase 1
protein O-mannosyltransferase 1
Name updated
1299863 APPROVED
2002-08-07
Pomt1
protein O-mannosyltransferase 1
Symbol and Name status set to provisional
70820 PROVISIONAL
