Advanced Search (OLGA)

Gene: Atp5mc2 (ATP synthase membrane subunit c locus 2) Rattus norvegicus

Analyze

Symbol:

Atp5mc2

Name:

ATP synthase membrane subunit c locus 2

RGD ID:

620051

Description:

Enables ligand-gated channel activity. Involved in pore complex assembly; response to 3,3',5-triiodo-L-thyronine; and response to ethanol. Part of cation channel complex. Human ortholog(s) of this gene implicated in renal cell carcinoma and urinary bladder cancer. Orthologous to human ATP5MC2 (ATP synthase membrane subunit c locus 2); PARTICIPATES IN electron transport chain pathway; Alzheimer's disease pathway; Huntington's disease pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acetamide; ammonium chloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ATP synthase F(0) complex subunit C2, mitochondrial; ATP synthase lipid-binding protein; ATP synthase lipid-binding protein, mitochondrial; ATP synthase proteolipid P2; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9); ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 2; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9); ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9); Atp5g2; ATPase protein 9; ATPase subunit c

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ATP5MC2 (ATP synthase membrane subunit c locus 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB
Mus musculus (house mouse):	Atp5mc2 (ATP synthase membrane subunit c locus 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Atp5mc2 (ATP synthase membrane subunit c locus 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ATP5MC2 (ATP synthase membrane subunit c locus 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ATP5MC2 (ATP synthase membrane subunit c locus 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Atp5mc2 (ATP synthase membrane subunit c locus 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ATP5MC2 (ATP synthase membrane subunit c locus 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ATP5MC2 (ATP synthase membrane subunit c locus 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Atp5mc2 (ATP synthase membrane subunit c locus 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Atp5mc2 (ATP synthase membrane subunit c locus 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ATP5MC3 (ATP synthase membrane subunit c locus 3)	HGNC	OrthoDB
Alliance orthologs ³
Mus musculus (house mouse):	Atp5mc2 (ATP synthase membrane subunit c locus 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ATP5MC2 (ATP synthase membrane subunit c locus 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	ATPsynC	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	OLI1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	OLI1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y82E9BR.3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y82E9BR.3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	atp5mc1	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	135,669,847 - 135,680,839 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	135,669,848 - 135,678,231 (-)	Ensembl				GRCr8
mRatBN7.2	7	133,791,341 - 133,799,713 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	133,791,342 - 133,799,733 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	135,547,188 - 135,555,690 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	137,776,552 - 137,785,054 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	137,762,671 - 137,771,041 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	144,264,207 - 144,272,578 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	144,264,199 - 144,272,578 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	142,056,425 - 142,064,796 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	141,412,892 - 141,421,263 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	130,218,595 - 130,226,966 (-)	NCBI		Celera
RGSC_v3.1	7	141,489,329 - 141,494,599 (-)	NCBI
Cytogenetic Map	7	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

clear cell renal cell carcinoma (ISO)

obesity (ISO)

renal cell carcinoma (ISO)

ST Elevation Myocardial Infarction (ISO)

urinary bladder cancer (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

acetamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

C60 fullerene (EXP)

CGP 52608 (ISO)

chlorpyrifos (ISO)

clobetasol (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

diarsenic trioxide (ISO)

disodium selenite (ISO)

doxorubicin (ISO)

fenthion (ISO)

genistein (EXP)

gentamycin (EXP)

ketoconazole (ISO)

lead(0) (ISO)

lipopolysaccharide (ISO)

metformin (ISO)

mono(2-ethylhexyl) phthalate (ISO)

nitrates (ISO)

okadaic acid (ISO)

oxybenzone (EXP)

ozone (EXP)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

poly(vinylpyrrolidone) (EXP)

resveratrol (ISO)

silicon dioxide (ISO)

silver atom (EXP)

silver(0) (EXP)

sodium arsenite (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

monoatomic ion transport (IEA)

pore complex assembly (IDA,IEA)

proton motive force-driven ATP synthesis (IBA,IEA)

proton transmembrane transport (IEA)

response to 3,3',5-triiodo-L-thyronine (IEP)

response to ethanol (IEA,IEP)

Cellular Component

cation channel complex (IDA,IEA)

mitochondrial membrane (IEA)

mitochondrion (ISO)

proton-transporting ATP synthase complex (IBA,IEA)

proton-transporting two-sector ATPase complex, proton-transporting domain (IEA)

Molecular Function

ligand-gated channel activity (IDA)

lipid binding (IEA)

protein binding (ISO)

proton transmembrane transporter activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

Alzheimer's disease pathway (IEA)

electron transport chain pathway (ISO)

Huntington's disease pathway (IEA)

oxidative phosphorylation pathway (IEA)

Parkinson's disease pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	ATP synthase subunit c expression: physiological regulation of the P1 and P2 genes.	Andersson U, etal., Biochem J. 1997 Apr 15;323 ( Pt 2):379-85.
2.	Systematic Analysis of the Expression of the Mitochondrial ATP Synthase (Complex V) Subunits in Clear Cell Renal Cell Carcinoma.	Brüggemann M, etal., Transl Oncol. 2017 Aug;10(4):661-668. doi: 10.1016/j.tranon.2017.06.002. Epub 2017 Jun 30.
3.	Fo ATP synthase C subunit serum levels in patients with ST-segment Elevation Myocardial Infarction: Preliminary findings.	Campo G, etal., Int J Cardiol. 2016 Oct 15;221:993-7. doi: 10.1016/j.ijcard.2016.07.125. Epub 2016 Jul 9.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
6.	Molecular cloning and sequence of cDNAs for the import precursors of oligomycin sensitivity conferring protein, ATPase inhibitor protein, and subunit c of H(+)-ATP synthase in rat mitochondria.	Higuti T, etal., Biochim Biophys Acta 1993 Mar 20;1172(3):311-4.
7.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
8.	Quantitative genome-wide methylation analysis of high-grade non-muscle invasive bladder cancer.	Kitchen MO, etal., Epigenetics. 2016 Mar 3;11(3):237-46. doi: 10.1080/15592294.2016.1154246. Epub 2016 Mar 1.
9.	Rat mitochondrial ATP synthase ATP5G3: cloning and upregulation in pancreas after chronic ethanol feeding.	Li HS, etal., Physiol Genomics 2001 Jul 17;6(2):91-8.
10.	Batten disease and the control of the Fo subunit c pore by cGMP and calcium.	McGeoch JE and Guidotti G, Eur J Paediatr Neurol. 2001;5 Suppl A:147-50.
11.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
12.	Genome-wide methylation analysis identifies epigenetically inactivated candidate tumour suppressor genes in renal cell carcinoma.	Morris MR, etal., Oncogene. 2011 Mar 24;30(12):1390-401. doi: 10.1038/onc.2010.525. Epub 2010 Dec 6.
13.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
14.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
15.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
16.	GOA pipeline	RGD automated data pipeline
17.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
18.	Comprehensive gene review and curation	RGD comprehensive gene curation
19.	Tumor suppressor RIZ1 in obesity and the PI3K/AKT/mTOR pathway.	Xie X, etal., Obesity (Silver Spring). 2016 Feb;24(2):389-97. doi: 10.1002/oby.21364. Epub 2015 Dec 26.

Additional References at PubMed

PMID:12477932	PMID:18614015	PMID:25002582	PMID:26316108	PMID:31904090	PMID:34800366

Genomics

Comparative Map Data

Atp5mc2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	135,669,847 - 135,680,839 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	135,669,848 - 135,678,231 (-)	Ensembl				GRCr8
mRatBN7.2	7	133,791,341 - 133,799,713 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	133,791,342 - 133,799,733 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	135,547,188 - 135,555,690 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	137,776,552 - 137,785,054 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	137,762,671 - 137,771,041 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	144,264,207 - 144,272,578 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	144,264,199 - 144,272,578 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	142,056,425 - 142,064,796 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	141,412,892 - 141,421,263 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	130,218,595 - 130,226,966 (-)	NCBI		Celera
RGSC_v3.1	7	141,489,329 - 141,494,599 (-)	NCBI
Cytogenetic Map	7	q36	NCBI

ATP5MC2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	53,665,170 - 53,681,423 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	53,632,726 - 53,677,651 (-)	Ensembl			hg38	GRCh38
GRCh37	12	54,058,954 - 54,070,114 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	52,345,211 - 52,356,779 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	12	52,345,215 - 52,356,165	NCBI
Celera	12	53,709,025 - 53,720,613 (-)	NCBI		Celera
Cytogenetic Map	12	q13.13	NCBI
HuRef	12	51,097,376 - 51,109,001 (-)	NCBI		HuRef
CHM1_1	12	54,025,876 - 54,037,448 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	53,631,253 - 53,647,563 (-)	NCBI		T2T-CHM13v2.0

Atp5mc2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	102,571,303 - 102,579,482 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	102,571,299 - 102,580,787 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	15	102,662,868 - 102,671,047 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	102,662,864 - 102,672,352 (-)	Ensembl			mm10	GRCm38
MGSCv37	15	102,493,299 - 102,501,478 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	15	102,490,902 - 102,499,081 (-)	NCBI		MGSCv36	mm8
Celera	17	6,359,298 - 6,359,944 (-)	NCBI		Celera
Cytogenetic Map	15	F3	NCBI
cM Map	15	57.77	NCBI

Atp5mc2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955458	952,817 - 959,962 (-)	Ensembl
ChiLan1.0	NW_004955458	952,817 - 960,963 (-)	NCBI	ChiLan1.0	ChiLan1.0

ATP5MC2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	40,508,284 - 40,520,592 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	40,505,381 - 40,517,356 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	35,078,290 - 35,089,480 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	35,864,248 - 35,876,216 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2

ATP5MC2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	27	1,569,776 - 1,577,713 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	27	44,672,389 - 44,680,274 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	27	1,573,699 - 1,581,579 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	27	1,529,406 - 1,581,519 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	27	1,590,540 - 1,598,409 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	27	1,572,800 - 1,580,666 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	27	45,075,335 - 45,083,213 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Atp5mc2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	62,248,091 - 62,255,913 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936512	10,908,881 - 10,918,445 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936512	10,908,915 - 10,918,445 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ATP5MC2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	18,871,026 - 18,879,609 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	5	18,871,025 - 18,879,933 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	19,407,979 - 19,415,736 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ATP5MC2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	49,768,977 - 49,780,664 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	49,768,783 - 49,780,081 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666037	196,264,489 - 196,276,629 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Atp5mc2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624904	1,742,367 - 1,751,250 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Atp5mc2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	260,415,380 - 260,423,860 (+)	NCBI		Rrattus_CSIRO_v1

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	100
Count of miRNA genes:	79
Interacting mature miRNAs:	81
Transcripts:	ENSRNOT00000020676
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354582	Stl11	Serum triglyceride level QTL 11	3.42		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	121393075	137014596	Rat
634331	Pia17	Pristane induced arthritis QTL 17	4.7		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	7	132099939	137014596	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	98549867	137014596	Rat
61428	Scl3	Serum cholesterol level QTL 3	3.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	100548246	137014596	Rat
61397	Bw17	Body weight QTL 17	6.3		body mass (VT:0001259)	body weight (CMO:0000012)	7	95485047	137014596	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	115313999	136544683	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	92362341	137014596	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	71827901	136544683	Rat
1357339	Stl14	Serum triglyceride level QTL 14	3.45	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	135371291	137014596	Rat

Markers in Region

PMC130177P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	7	q36	UniSTS

D12S2096

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	133,791,288 - 133,791,441 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	144,264,155 - 144,264,307	NCBI	Rnor6.0
Rnor_5.0	7	142,056,373 - 142,056,525	UniSTS	Rnor5.0
RGSC_v3.4	7	141,412,840 - 141,412,992	UniSTS	RGSC3.4
Celera	7	130,218,543 - 130,218,695	UniSTS
Cytogenetic Map	7	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_133556	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039078345	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063262948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC128726	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474035	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D13124	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209535	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223576	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ235238	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000020676 ⟹ ENSRNOP00000020675

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	135,669,854 - 135,678,231 (-)	Ensembl
mRatBN7.2 Ensembl	7	133,791,344 - 133,799,733 (-)	Ensembl
Rnor_6.0 Ensembl	7	144,264,214 - 144,272,578 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000090051 ⟹ ENSRNOP00000068783

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	135,669,848 - 135,673,349 (-)	Ensembl
mRatBN7.2 Ensembl	7	133,791,342 - 133,794,843 (-)	Ensembl
Rnor_6.0 Ensembl	7	144,264,199 - 144,269,486 (-)	Ensembl

RefSeq Acc Id:

NM_133556 ⟹ NP_598240

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	135,669,847 - 135,678,218 (-)	NCBI
mRatBN7.2	7	133,791,341 - 133,799,713 (-)	NCBI
Rnor_6.0	7	144,264,207 - 144,272,578 (-)	NCBI
Rnor_5.0	7	142,056,425 - 142,064,796 (-)	NCBI
RGSC_v3.4	7	141,412,892 - 141,421,263 (-)	RGD
Celera	7	130,218,595 - 130,226,966 (-)	RGD

Sequence:

show sequence

CTCTACCCTGGGAGCAGCTCTTCTGCCTTTGCCCCTCACCCCTGAAAAATGTATGCCTGCTCCA
AGTTCGTCTCTACCCGCTCCCTGATCAGGAGCACCTCTCAGCTGCTGAGCCGTCCGCTCTCTGC
AGTGGAGTTAAAGCGACCACAGATGCCCACAGATGAGGGCCTCAGCTGCTTGGCAGTCCGGCGG
CCTCTGACCTCGCTTATCCCTAGCCGCAGCTTCCAAACCAGCGCCATTTCAAGGGACATTGACA
CAGCTGCCAAGTTCATTGGAGCTGGGGCTGCTACAGTTGGGGTGGCCGGTTCTGGAGCAGGAAT
TGGGACTGTTTTTGGGAGTCTCATCATTGGCTATGCCAGGAACCCCTCTCTGAAGCAGCAACTC
TTCTCCTATGCGATTCTGGGCTTCGCCCTCTCTGAGGCCATGGGGCTCTTTTGCCTAATGGTGG
CCTTCCTCATCCTCTTCGCCATGTGAAGCAGCTGTCTCCACGTCCACCTCCCATGGTTCTTCCG
TGTCTCGTCTGCCCTGTGTGTTCCTTTTCCTGTGCCTCCCCAAGAAGTCTGGGGAAAGTGCTTG
GCTCAGGGTTTGACAGAGAGAAGACAAATAAATACTGTATTAATAAGAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039078345 ⟹ XP_038934273

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	135,669,847 - 135,678,246 (-)	NCBI
mRatBN7.2	7	133,791,341 - 133,798,786 (-)	NCBI

RefSeq Acc Id:

XM_063262948 ⟹ XP_063119018

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	135,669,847 - 135,680,839 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_598240	(Get FASTA)	NCBI Sequence Viewer
	XP_038934273	(Get FASTA)	NCBI Sequence Viewer
	XP_063119018	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI28727	(Get FASTA)	NCBI Sequence Viewer
	BAA02426	(Get FASTA)	NCBI Sequence Viewer
	EDL86816	(Get FASTA)	NCBI Sequence Viewer
	EDL86817	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000020675
	ENSRNOP00000020675.3
GenBank Protein	Q06646	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_598240 ⟸ NM_133556
- Peptide Label:	precursor
- UniProtKB:	A2VCW6 (UniProtKB/Swiss-Prot), Q06646 (UniProtKB/Swiss-Prot), A6KCX5 (UniProtKB/TrEMBL), A0A8I6AM76 (UniProtKB/TrEMBL)
- Sequence:	show sequence MYACSKFVSTRSLIRSTSQLLSRPLSAVELKRPQMPTDEGLSCLAVRRPLTSLIPSRSFQTSAI SRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGL FCLMVAFLILFAM hide sequence

Ensembl Acc Id:

ENSRNOP00000068783 ⟸ ENSRNOT00000090051

Ensembl Acc Id:

ENSRNOP00000020675 ⟸ ENSRNOT00000020676

RefSeq Acc Id:	XP_038934273 ⟸ XM_039078345
- Peptide Label:	isoform X1
- UniProtKB:	Q06646 (UniProtKB/Swiss-Prot), A2VCW6 (UniProtKB/Swiss-Prot), A6KCX5 (UniProtKB/TrEMBL), A0A8I6AM76 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063119018 ⟸ XM_063262948
- Peptide Label:	isoform X1
- UniProtKB:	Q06646 (UniProtKB/Swiss-Prot), A2VCW6 (UniProtKB/Swiss-Prot), A6KCX5 (UniProtKB/TrEMBL), A0A8I6AM76 (UniProtKB/TrEMBL)

Protein Domains

V-ATPase proteolipid subunit C-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q06646-F1-model_v2	AlphaFold	Q06646	1-141	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695706

Promoter ID:

EPDNEW_R6231

Type:

initiation region

Name:

Atp5mc2_1

Description:

ATP synthase membrane subunit c locus 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	144,272,592 - 144,272,652	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620051	AgrOrtholog
BioCyc Gene	G2FUF-31929	BioCyc
BioCyc Pathway	PWY-7980 [ATP biosynthesis]	BioCyc
BioCyc Pathway Image	PWY-7980	BioCyc
Ensembl Genes	ENSRNOG00000015320	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000020676	ENTREZGENE
	ENSRNOT00000020676.7	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.20.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7321526	IMAGE-MGC_LOAD
InterPro	ATP_synth_F0_csu	UniProtKB/Swiss-Prot
	ATP_synth_F0_csu_DDCD_BS	UniProtKB/Swiss-Prot
	ATP_synth_F0_csu_sf	UniProtKB/Swiss-Prot
	ATPase_proteolipid_c-like_dom	UniProtKB/Swiss-Prot
	F/V-ATP_Csub_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:171082	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:156595	IMAGE-MGC_LOAD
NCBI Gene	171082	ENTREZGENE
PANTHER	ATP SYNTHASE F(0) COMPLEX SUBUNIT C3, MITOCHONDRIAL	UniProtKB/Swiss-Prot
	PTHR10031	UniProtKB/Swiss-Prot
Pfam	ATP-synt_C	UniProtKB/Swiss-Prot
PhenoGen	Atp5mc2	PhenoGen
PRINTS	ATPASEC	UniProtKB/Swiss-Prot
PROSITE	ATPASE_C	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000015320	RatGTEx
Superfamily-SCOP	SSF81333	UniProtKB/Swiss-Prot
UniProt	A0A8I6AM76	ENTREZGENE, UniProtKB/TrEMBL
	A2VCW6	ENTREZGENE
	A6KCX5	ENTREZGENE, UniProtKB/TrEMBL
	AT5G2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
UniProt Secondary	A2VCW6	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-11-30	Atp5mc2	ATP synthase membrane subunit c locus 2	Atp5g2	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-12-01	Atp5g2	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9)	Atp5g2	ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-06-27	Atp5g2	ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9)	Atp5g2	ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-02-26	Atp5g2	ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 2			Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Atp5g2	ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways