Symbol:
Nme3
Name:
NME/NM23 nucleoside diphosphate kinase 3
RGD ID:
619879
Description:
Predicted to enable nucleoside diphosphate kinase activity. Predicted to be involved in DNA repair; mitochondrial fusion; and nucleoside triphosphate biosynthetic process. Predicted to be located in ciliary basal body and mitochondrial outer membrane. Orthologous to human NME3 (NME/NM23 nucleoside diphosphate kinase 3); PARTICIPATES IN de novo pyrimidine biosynthetic pathway; purine metabolic pathway; pyrimidine metabolic pathway; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
expressed in non-metastatic cells 3; expressed in non-metastatic cells 3 protein (nucleoside diphosphate kinase); expressed in non-metastatic cells 3, protein (nucleoside diphosphate kinase); NM23-dr; non-metastatic cell expressed protein 3; non-metastatic cells 3, protein expressed in; nucleoside diphosphate kinase 3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NME3 (NME/NM23 nucleoside diphosphate kinase 3)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Nme3 (NME/NM23 nucleoside diphosphate kinase 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Nme3 (NME/NM23 nucleoside diphosphate kinase 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NME3 (NME/NM23 nucleoside diphosphate kinase 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NME3 (NME/NM23 nucleoside diphosphate kinase 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Nme3 (NME/NM23 nucleoside diphosphate kinase 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NME3 (NME/NM23 nucleoside diphosphate kinase 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NME3 (NME/NM23 nucleoside diphosphate kinase 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Nme3 (NME/NM23 nucleoside diphosphate kinase 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
NME3 (NME/NM23 nucleoside diphosphate kinase 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Nme3 (NME/NM23 nucleoside diphosphate kinase 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
nme3 (NME/NM23 nucleoside diphosphate kinase 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
ndk-1
Alliance
DIOPT (OMA|OrthoFinder|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
YNK1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
awd
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
nme3
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 14,421,922 - 14,422,878 (+) NCBI GRCr8 mRatBN7.2 10 13,917,309 - 13,918,415 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 13,917,403 - 13,918,359 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 18,664,513 - 18,665,469 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 18,153,373 - 18,154,329 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 13,652,590 - 13,653,546 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 14,258,232 - 14,259,365 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 14,258,380 - 14,259,336 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 14,074,396 - 14,075,352 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 14,145,488 - 14,146,444 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 14,145,487 - 14,146,444 (+) NCBI Celera 10 13,596,611 - 13,597,567 (+) NCBI Celera Cytogenetic Map 10 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nme3 Rat (+)-catechin multiple interactions ISO NME3 (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in decreased expression of NME3 mRNA CTD PMID:24763279 Nme3 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of NME3 mRNA] CTD PMID:31150632 Nme3 Rat (S)-nicotine decreases expression ISO NME3 (Homo sapiens) 6480464 Nicotine results in decreased expression of NME3 mRNA CTD PMID:18247414 Nme3 Rat 1,2-dimethylhydrazine multiple interactions ISO Nme3 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of NME3 mRNA CTD PMID:22206623 Nme3 Rat 17beta-estradiol decreases expression ISO NME3 (Homo sapiens) 6480464 Estradiol results in decreased expression of NME3 mRNA CTD PMID:23373633 Nme3 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of NME3 mRNA CTD PMID:32145629 Nme3 Rat 17beta-estradiol multiple interactions ISO NME3 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of NME3 mRNA CTD PMID:30165855 Nme3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NME3 mRNA CTD PMID:21215274 Nme3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of NME3 mRNA CTD PMID:32109520 Nme3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Nme3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of NME3 mRNA CTD PMID:21570461 Nme3 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of NME3 mRNA CTD PMID:21346803 Nme3 Rat 2-naphthylamine decreases expression ISO NME3 (Homo sapiens) 6480464 2-Naphthylamine results in decreased expression of NME3 mRNA CTD PMID:18247414 Nme3 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO Nme3 (Mus musculus) 6480464 tetrabromobisphenol A results in decreased expression of NME3 mRNA CTD PMID:25172293 Nme3 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO NME3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of NME3 mRNA CTD PMID:28628672 Nme3 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Nme3 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of NME3 mRNA CTD PMID:18648102 Nme3 Rat 4,4'-sulfonyldiphenol affects methylation ISO Nme3 (Mus musculus) 6480464 bisphenol S affects the methylation of NME3 gene CTD PMID:31683443 Nme3 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of NME3 mRNA CTD PMID:31881176 Nme3 Rat afimoxifene decreases response to substance ISO NME3 (Homo sapiens) 6480464 NME3 results in decreased susceptibility to afimoxifene CTD PMID:21233418 Nme3 Rat aflatoxin B1 increases methylation ISO NME3 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of NME3 polyA tail CTD PMID:30157460 Nme3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of NME3 mRNA CTD PMID:16483693 Nme3 Rat aristolochic acid A decreases expression ISO NME3 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of NME3 mRNA CTD PMID:33212167 Nme3 Rat arsenite(3-) increases expression ISO Nme3 (Mus musculus) 6480464 arsenite results in increased expression of NME3 protein CTD PMID:37955338 Nme3 Rat atrazine increases expression EXP 6480464 Atrazine results in increased expression of NME3 mRNA CTD PMID:36841081 Nme3 Rat benzo[a]pyrene decreases expression ISO NME3 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of NME3 mRNA CTD PMID:18247414 Nme3 Rat benzo[a]pyrene increases methylation ISO NME3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of NME3 promoter CTD PMID:27901495 Nme3 Rat beta-lapachone decreases expression ISO NME3 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of NME3 mRNA CTD PMID:38218311 Nme3 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in increased expression of NME3 mRNA CTD PMID:26496021 Nme3 Rat bisphenol A increases expression ISO Nme3 (Mus musculus) 6480464 bisphenol A results in increased expression of NME3 mRNA CTD PMID:38074096 Nme3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NME3 mRNA CTD PMID:30816183 more ... Nme3 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of NME3 gene CTD PMID:28505145 Nme3 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of NME3 mRNA CTD PMID:25181051 Nme3 Rat bisphenol AF increases expression ISO NME3 (Homo sapiens) 6480464 bisphenol AF results in increased expression of NME3 protein CTD PMID:34186270 Nme3 Rat Bisphenol B increases expression ISO NME3 (Homo sapiens) 6480464 bisphenol B results in increased expression of NME3 protein CTD PMID:34186270 Nme3 Rat bisphenol F multiple interactions ISO NME3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of NME3 mRNA CTD PMID:28628672 Nme3 Rat buspirone increases expression EXP 6480464 Buspirone results in increased expression of NME3 mRNA CTD PMID:24136188 Nme3 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of NME3 mRNA CTD PMID:33453195 Nme3 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of NME3 mRNA CTD PMID:25993096 Nme3 Rat carbamazepine affects expression ISO NME3 (Homo sapiens) 6480464 Carbamazepine affects the expression of NME3 mRNA CTD PMID:25979313 Nme3 Rat carbon nanotube decreases expression ISO Nme3 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Nme3 Rat cisplatin multiple interactions ISO NME3 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of NME3 mRNA CTD PMID:27392435 Nme3 Rat clofibrate decreases expression ISO Nme3 (Mus musculus) 6480464 Clofibrate results in decreased expression of NME3 mRNA CTD PMID:23811191 Nme3 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of NME3 mRNA CTD PMID:22465980 Nme3 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of NME3 mRNA CTD PMID:30556269 Nme3 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of NME3 mRNA CTD PMID:22465980 Nme3 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of NME3 mRNA CTD PMID:30556269 Nme3 Rat cyclosporin A decreases expression ISO NME3 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of NME3 mRNA CTD PMID:20106945 Nme3 Rat cyclosporin A decreases expression ISO Nme3 (Mus musculus) 6480464 Cyclosporine results in decreased expression of NME3 mRNA CTD PMID:19770486 Nme3 Rat dexamethasone multiple interactions ISO NME3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of NME3 mRNA CTD PMID:28628672 Nme3 Rat diazinon affects expression EXP 6480464 Diazinon affects the expression of NME3 mRNA CTD PMID:22546817 Nme3 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of NME3 mRNA CTD PMID:21266533 Nme3 Rat dibutyl phthalate decreases expression ISO Nme3 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of NME3 mRNA CTD PMID:17361019 and PMID:21266533 Nme3 Rat disodium selenite increases expression ISO NME3 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of NME3 mRNA CTD PMID:18175754 Nme3 Rat doxorubicin decreases expression ISO NME3 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of NME3 mRNA CTD PMID:29803840 Nme3 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of NME3 mRNA CTD PMID:29391264 Nme3 Rat enzyme inhibitor multiple interactions ISO NME3 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of NME3 protein CTD PMID:23301498 Nme3 Rat ethyl methanesulfonate decreases expression ISO NME3 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of NME3 mRNA CTD PMID:23649840 Nme3 Rat folic acid multiple interactions ISO Nme3 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of NME3 mRNA CTD PMID:22206623 Nme3 Rat formaldehyde decreases expression ISO NME3 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of NME3 mRNA CTD PMID:23649840 Nme3 Rat furan increases methylation EXP 6480464 furan results in increased methylation of NME3 gene CTD PMID:22079235 Nme3 Rat furan decreases expression EXP 6480464 furan results in decreased expression of NME3 mRNA CTD PMID:25539665 and PMID:26194646 Nme3 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of NME3 mRNA CTD PMID:24136188 Nme3 Rat indometacin multiple interactions ISO NME3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of NME3 mRNA CTD PMID:28628672 Nme3 Rat indometacin decreases expression EXP 6480464 Indomethacin results in decreased expression of NME3 mRNA CTD PMID:36868495 Nme3 Rat methyl methanesulfonate decreases expression ISO NME3 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of NME3 mRNA CTD PMID:23649840 Nme3 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal decreases expression ISO Nme3 (Mus musculus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in decreased expression of NME3 mRNA CTD PMID:25566086 Nme3 Rat nickel atom decreases expression ISO NME3 (Homo sapiens) 6480464 Nickel results in decreased expression of NME3 mRNA CTD PMID:25583101 Nme3 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of NME3 mRNA CTD PMID:22110744 and PMID:22546817 Nme3 Rat nicotine decreases expression ISO NME3 (Homo sapiens) 6480464 Nicotine results in decreased expression of NME3 mRNA CTD PMID:18247414 Nme3 Rat p-menthan-3-ol decreases expression ISO NME3 (Homo sapiens) 6480464 Menthol results in decreased expression of NME3 mRNA CTD PMID:26760959 Nme3 Rat paracetamol affects expression ISO Nme3 (Mus musculus) 6480464 Acetaminophen affects the expression of NME3 mRNA CTD PMID:17562736 Nme3 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of NME3 mRNA CTD PMID:33387578 Nme3 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of NME3 mRNA CTD PMID:32680482 Nme3 Rat pirinixic acid multiple interactions ISO NME3 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of NME3 mRNA CTD PMID:19710929 Nme3 Rat pirinixic acid decreases expression ISO Nme3 (Mus musculus) 6480464 pirinixic acid results in decreased expression of NME3 mRNA CTD PMID:18445702 Nme3 Rat silver atom decreases expression ISO Nme3 (Mus musculus) 6480464 Silver results in decreased expression of NME3 mRNA CTD PMID:27131904 Nme3 Rat silver(0) decreases expression ISO Nme3 (Mus musculus) 6480464 Silver results in decreased expression of NME3 mRNA CTD PMID:27131904 Nme3 Rat sodium arsenite decreases expression ISO NME3 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of NME3 mRNA CTD PMID:38568856 Nme3 Rat sodium fluoride increases expression ISO Nme3 (Mus musculus) 6480464 Sodium Fluoride results in increased expression of NME3 protein CTD PMID:28918527 Nme3 Rat sunitinib decreases expression ISO NME3 (Homo sapiens) 6480464 Sunitinib results in decreased expression of NME3 mRNA CTD PMID:31533062 Nme3 Rat temozolomide increases expression ISO NME3 (Homo sapiens) 6480464 Temozolomide results in increased expression of NME3 mRNA CTD PMID:31758290 Nme3 Rat testosterone multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in increased expression of NME3 mRNA CTD PMID:26496021 Nme3 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of NME3 mRNA] CTD PMID:31150632 Nme3 Rat tetrachloromethane decreases expression ISO Nme3 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of NME3 mRNA CTD PMID:31919559 Nme3 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of NME3 mRNA CTD PMID:31150632 Nme3 Rat thapsigargin increases expression ISO NME3 (Homo sapiens) 6480464 Thapsigargin results in increased expression of NME3 mRNA CTD PMID:22378314 Nme3 Rat thapsigargin decreases expression ISO NME3 (Homo sapiens) 6480464 Thapsigargin results in decreased expression of NME3 mRNA CTD PMID:29453283 Nme3 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of NME3 mRNA CTD PMID:16337175 more ... Nme3 Rat thiram decreases expression ISO NME3 (Homo sapiens) 6480464 Thiram results in decreased expression of NME3 mRNA CTD PMID:38568856 Nme3 Rat tolcapone decreases expression EXP 6480464 tolcapone results in decreased expression of NME3 mRNA CTD PMID:24136188 Nme3 Rat toluene decreases expression EXP 6480464 Toluene results in decreased expression of NME3 mRNA CTD PMID:22967744 Nme3 Rat urethane decreases expression ISO NME3 (Homo sapiens) 6480464 Urethane results in decreased expression of NME3 mRNA CTD PMID:28818685 Nme3 Rat valproic acid increases methylation ISO NME3 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of NME3 gene CTD PMID:29154799 Nme3 Rat valproic acid affects expression ISO Nme3 (Mus musculus) 6480464 Valproic Acid affects the expression of NME3 mRNA CTD PMID:17292431 Nme3 Rat valproic acid decreases expression ISO Nme3 (Mus musculus) 6480464 Valproic Acid results in decreased expression of NME3 mRNA CTD PMID:21427059 Nme3 Rat valproic acid decreases expression ISO NME3 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of NME3 mRNA CTD PMID:23179753 Nme3 Rat valproic acid affects expression ISO NME3 (Homo sapiens) 6480464 Valproic Acid affects the expression of NME3 mRNA CTD PMID:25979313 Nme3 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of NME3 mRNA CTD PMID:23034163
Imported Annotations - KEGG (archival)
(+)-catechin (ISO) (+)-schisandrin B (EXP) (S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2-naphthylamine (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) acetamide (EXP) afimoxifene (ISO) aflatoxin B1 (ISO) ammonium chloride (EXP) aristolochic acid A (ISO) arsenite(3-) (ISO) atrazine (EXP) benzo[a]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) buspirone (EXP) cadmium dichloride (EXP) carbamazepine (ISO) carbon nanotube (ISO) cisplatin (ISO) clofibrate (ISO) copper atom (EXP) copper(0) (EXP) cyclosporin A (ISO) dexamethasone (ISO) diazinon (EXP) dibutyl phthalate (EXP,ISO) disodium selenite (ISO) doxorubicin (ISO) endosulfan (EXP) enzyme inhibitor (ISO) ethyl methanesulfonate (ISO) folic acid (ISO) formaldehyde (ISO) furan (EXP) glafenine (EXP) indometacin (EXP,ISO) methyl methanesulfonate (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) nickel atom (ISO) nickel dichloride (EXP) nicotine (ISO) p-menthan-3-ol (ISO) paracetamol (EXP,ISO) paraquat (EXP) pirinixic acid (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sodium fluoride (ISO) sunitinib (ISO) temozolomide (ISO) testosterone (EXP) tetrachloromethane (EXP,ISO) thapsigargin (ISO) thioacetamide (EXP) thiram (ISO) tolcapone (EXP) toluene (EXP) urethane (ISO) valproic acid (ISO) vinclozolin (EXP)
Nme3 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 14,421,922 - 14,422,878 (+) NCBI GRCr8 mRatBN7.2 10 13,917,309 - 13,918,415 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 13,917,403 - 13,918,359 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 18,664,513 - 18,665,469 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 18,153,373 - 18,154,329 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 13,652,590 - 13,653,546 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 14,258,232 - 14,259,365 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 14,258,380 - 14,259,336 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 14,074,396 - 14,075,352 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 14,145,488 - 14,146,444 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 14,145,487 - 14,146,444 (+) NCBI Celera 10 13,596,611 - 13,597,567 (+) NCBI Celera Cytogenetic Map 10 q12 NCBI
NME3 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 1,770,320 - 1,771,543 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 1,770,320 - 1,771,561 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 1,820,321 - 1,821,544 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 1,760,322 - 1,761,711 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 1,760,322 - 1,761,711 NCBI Celera 16 2,032,596 - 2,033,985 (-) NCBI Celera Cytogenetic Map 16 p13.3 NCBI HuRef 16 1,743,213 - 1,744,602 (-) NCBI HuRef CHM1_1 16 1,820,269 - 1,821,658 (-) NCBI CHM1_1 T2T-CHM13v2.0 16 1,786,150 - 1,787,373 (-) NCBI T2T-CHM13v2.0
Nme3 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 25,115,474 - 25,116,505 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 25,115,474 - 25,116,496 (+) Ensembl GRCm39 Ensembl GRCm38 17 24,896,500 - 24,897,531 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 24,896,500 - 24,897,522 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 25,033,445 - 25,034,476 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 24,624,106 - 24,625,103 (+) NCBI MGSCv36 mm8 Celera 17 25,423,190 - 25,424,231 (+) NCBI Celera Cytogenetic Map 17 A3.3 NCBI cM Map 17 12.53 NCBI
Nme3 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955442 15,497,779 - 15,498,873 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955442 15,497,779 - 15,498,873 (+) NCBI ChiLan1.0 ChiLan1.0
NME3 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 2,036,976 - 2,038,428 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 5,818,421 - 5,819,857 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 392,694 - 394,106 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 1,822,719 - 1,824,160 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 1,822,719 - 1,824,147 (-) Ensembl panpan1.1 panPan2
NME3 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 39,131,807 - 39,132,756 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 40,370,445 - 40,371,394 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 39,447,987 - 39,448,936 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 6 39,124,673 - 39,125,622 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 39,097,254 - 39,098,202 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 39,575,702 - 39,576,651 (+) NCBI UU_Cfam_GSD_1.0
Nme3 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 104,486,486 - 104,487,636 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936694 2,221,915 - 2,222,814 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936694 2,222,055 - 2,222,977 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NME3 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 40,195,635 - 40,196,869 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 40,195,456 - 40,197,121 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 41,659,552 - 41,661,739 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NME3 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 1,679,361 - 1,680,796 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 1,679,549 - 1,680,547 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666068 29,405,487 - 29,406,892 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Nme3 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 94 Count of miRNA genes: 82 Interacting mature miRNAs: 87 Transcripts: ENSRNOT00000021650 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 2313066 Bss63 Bone structure and strength QTL 63 1.4 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 10 5387014 50387014 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 2313064 Bmd71 Bone mineral density QTL 71 0.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 10 5387014 50387014 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 634329 Pia15 Pristane induced arthritis QTL 15 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 1 24158324 Rat 1578761 Stresp21 Stress response QTL 21 3.3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 6375746 51375746 Rat 2293680 Bss40 Bone structure and strength QTL 40 5.66 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 10 1 35225947 Rat 7387235 Uae41 Urinary albumin excretion QTL 41 5.26 0.1874 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 10 1 29497586 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 10401803 Kidm50 Kidney mass QTL 50 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 10 418344 45418344 Rat 737820 Alc9 Alcohol consumption QTL 9 2.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 10 5144027 19233348 Rat 2313081 Bss64 Bone structure and strength QTL 64 1.3 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 10 5387014 50387014 Rat 631828 Alc5 Alcohol consumption QTL 5 2.4 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 10 5144027 17245662 Rat 634327 Hc4 Hypercalciuria QTL 4 2.4 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 10 1 38328221 Rat 2313095 Bss62 Bone structure and strength QTL 62 1.5 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 631660 Hcar1 Hepatocarcinoma resistance QTL 1 3.4 0.0001 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 10 6154182 15990232 Rat 1576304 Schws7 Schwannoma susceptibility QTL 7 0.0115 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 4765527 19816042 Rat 7411611 Foco17 Food consumption QTL 17 18.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 1 42315980 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 2313104 Bss61 Bone structure and strength QTL 61 0.9 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat
AV001970
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 13,916,911 - 13,917,007 (+) MAPPER mRatBN7.2 Rnor_6.0 10 14,257,889 - 14,257,984 NCBI Rnor6.0 Rnor_5.0 10 14,073,905 - 14,074,000 UniSTS Rnor5.0 RGSC_v3.4 10 14,144,997 - 14,145,092 UniSTS RGSC3.4 Celera 10 13,596,120 - 13,596,215 UniSTS Cytogenetic Map 10 q12 UniSTS
AI575323
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 13,918,169 - 13,918,366 (+) MAPPER mRatBN7.2 Rnor_6.0 10 14,259,147 - 14,259,343 NCBI Rnor6.0 Rnor_5.0 10 14,075,163 - 14,075,359 UniSTS Rnor5.0 RGSC_v3.4 10 14,146,255 - 14,146,451 UniSTS RGSC3.4 Celera 10 13,597,378 - 13,597,574 UniSTS RH 3.4 Map 10 171.0 UniSTS Cytogenetic Map 10 q12 UniSTS
RH129468
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 13,916,916 - 13,917,102 (+) MAPPER mRatBN7.2 Rnor_6.0 10 14,257,894 - 14,258,079 NCBI Rnor6.0 Rnor_5.0 10 14,073,910 - 14,074,095 UniSTS Rnor5.0 RGSC_v3.4 10 14,145,002 - 14,145,187 UniSTS RGSC3.4 Celera 10 13,596,125 - 13,596,310 UniSTS Cytogenetic Map 10 q12 UniSTS
RH143979
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 13,918,499 - 13,918,599 (+) MAPPER mRatBN7.2 Rnor_6.0 10 14,259,477 - 14,259,576 NCBI Rnor6.0 Rnor_5.0 10 14,075,493 - 14,075,592 UniSTS Rnor5.0 RGSC_v3.4 10 14,146,585 - 14,146,684 UniSTS RGSC3.4 Celera 10 13,597,708 - 13,597,807 UniSTS RH 3.4 Map 10 174.1 UniSTS Cytogenetic Map 10 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000021650 ⟹ ENSRNOP00000021650
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 13,917,403 - 13,918,359 (+) Ensembl Rnor_6.0 Ensembl 10 14,258,380 - 14,259,336 (+) Ensembl
RefSeq Acc Id:
NM_053507 ⟹ NP_445959
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 14,421,922 - 14,422,878 (+) NCBI mRatBN7.2 10 13,917,403 - 13,918,359 (+) NCBI Rnor_6.0 10 14,258,380 - 14,259,336 (+) NCBI Rnor_5.0 10 14,074,396 - 14,075,352 (+) NCBI RGSC_v3.4 10 14,145,488 - 14,146,444 (+) RGD Celera 10 13,596,611 - 13,597,567 (+) RGD
Sequence:
CATGATCTGTCTGGTGCTGACCATCTTTGCTAACCTCTTCCCCTCAGCCTACAGCGGCGTGAACGAGCGCACGTTCTTGGCAGTGAAGCCCGACGGCGTGCAGCGGCGGCTGGTGGGCGAGATCGTGC GTCGCTTTGAAAGGAAGGGCTTCAAGCTGGTGGCACTGAAGCTAGTGCAGGCCTCCGAAGAGCTACTGCGGGAGCATTATGTCGAGCTGCGGGAGAGACCTTTCTACAGCCGATTAGTTAAATACATG GGCTCTGGTCCCGTGGTGGCCATGGTGTGGCAAGGGCTGGATGTCGTGCGCGCTTCGCGGGCCCTCATAGGGGCCACTGACCCAGGGGACGCCACGCCCGGTACGATCCGTGGTGATTTCTGTGTGGA GGTTGGCAAGAATGTGATTCATGGCAGTGATTCGGTGGAAAGTGCTCAGAGAGAGATCGCTCTTTGGTTCCGTGAGGATGAGCTTCTGTGCTGGGAGGACAGCGCGGGACACTGGCTATATGAGTAGA CGCTAAAATCAACATTACCAATCTGGAGGTTGTTGGTCTTCTGTGATCTTCACAGTGACAGTGCTATGTGGGTGCAGGTCCACCCAACCCAGTCTGTCCAGGGGCAACCACTTCCACATCCCACCCTC TATTT
hide sequence
RefSeq Acc Id:
NP_445959 ⟸ NM_053507
- Peptide Label:
precursor
- UniProtKB:
Q99NI1 (UniProtKB/TrEMBL), G3V816 (UniProtKB/TrEMBL), A6HCY6 (UniProtKB/TrEMBL)
- Sequence:
MICLVLTIFANLFPSAYSGVNERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYVELRERPFYSRLVKYMGSGPVVAMVWQGLDVVRASRALIGATDPGDATPGTIRGDFCVE VGKNVIHGSDSVESAQREIALWFREDELLCWEDSAGHWLYE
hide sequence
Ensembl Acc Id:
ENSRNOP00000021650 ⟸ ENSRNOT00000021650
RGD ID: 13697037
Promoter ID: EPDNEW_R7560
Type: initiation region
Name: Nme3_1
Description: NME/NM23 nucleoside diphosphate kinase 3
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 14,258,371 - 14,258,431 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-10-05
Nme3
NME/NM23 nucleoside diphosphate kinase 3
Nme3
non-metastatic cells 3, protein expressed in
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2008-03-14
Nme3
non-metastatic cells 3, protein expressed in
Nme3
expressed in non-metastatic cells 3
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2008-02-22
Nme3
expressed in non-metastatic cells 3
Nme3
non-metastatic cell expressed protein 3
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2005-11-17
Nme3
non-metastatic cell expressed protein 3
non-metastatic cells 3, protein expressed in
Name updated
1299863
APPROVED
2005-01-20
Nme3
non-metastatic cells 3, protein expressed in
expressed in non-metastatic cells 3, protein (nucleoside diphosphate kinase)
Name updated
1299863
APPROVED
2002-08-07
Nme3
expressed in non-metastatic cells 3, protein (nucleoside diphosphate kinase)
Symbol and Name status set to provisional
70820
PROVISIONAL