Symbol:
A1cf
Name:
APOBEC1 complementation factor
RGD ID:
619834
Description:
Enables mRNA binding activity. Involved in cytidine to uridine editing and positive regulation of protein secretion. Located in cytoplasm and heterochromatin. Part of mRNA editing complex. Human ortholog(s) of this gene implicated in gout. Orthologous to human A1CF (APOBEC1 complementation factor); INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
A1cft; Acf; Apobec-1; apobec-1 complementation factor; Apobec-1 complementation factor APOBEC-1 stimulating protein; Apobec-1 complementation factor, APOBEC-1 stimulating protein; APOBEC1 complementation factorT; APOBEC1-stimulating protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 239,149,436 - 239,242,460 (+) NCBI GRCr8 mRatBN7.2 1 229,736,037 - 229,823,499 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 229,736,106 - 229,824,354 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 238,102,542 - 238,188,586 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 245,032,243 - 245,118,286 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 237,866,865 - 237,946,606 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 250,426,027 - 250,514,245 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 250,426,158 - 250,514,866 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 257,660,187 - 257,747,893 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 235,865,843 - 235,958,065 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 236,029,865 - 236,122,088 (+) NCBI Celera 1 226,856,680 - 226,943,695 (+) NCBI Celera Cytogenetic Map 1 q52 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
A1cf Rat (+)-catechin multiple interactions ISO A1CF (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in decreased expression of A1CF mRNA CTD PMID:24763279 A1cf Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of A1CF mRNA] CTD PMID:31150632 A1cf Rat 1,2-dimethylhydrazine increases expression ISO A1cf (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of A1CF mRNA CTD PMID:22206623 A1cf Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of A1CF mRNA CTD PMID:32145629 A1cf Rat 17beta-estradiol decreases expression ISO A1cf (Mus musculus) 6480464 Estradiol results in decreased expression of A1CF mRNA CTD PMID:39298647 A1cf Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of A1CF mRNA CTD PMID:21215274 and PMID:21724226 A1cf Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO A1cf (Mus musculus) 6480464 2 more ... CTD PMID:38648751 A1cf Rat 4,4'-sulfonyldiphenol decreases expression ISO A1CF (Homo sapiens) 6480464 bisphenol S results in decreased expression of A1CF mRNA CTD PMID:30616060 A1cf Rat 4,4'-sulfonyldiphenol affects methylation ISO A1cf (Mus musculus) 6480464 bisphenol S affects the methylation of A1CF gene CTD PMID:31683443 A1cf Rat 4,4'-sulfonyldiphenol affects expression ISO A1cf (Mus musculus) 6480464 bisphenol S affects the expression of A1CF mRNA CTD PMID:39298647 A1cf Rat 4-hydroxyphenyl retinamide increases expression ISO A1cf (Mus musculus) 6480464 Fenretinide results in increased expression of A1CF mRNA CTD PMID:28973697 A1cf Rat 7,9-dihydro-1H-purine-2,6,8(3H)-trione affects abundance ISO A1CF (Homo sapiens) 6480464 A1CF gene SNP affects the abundance of Uric Acid CTD PMID:23263486 A1cf Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of A1CF mRNA CTD PMID:28959563 A1cf Rat acrylamide decreases expression ISO A1cf (Mus musculus) 6480464 Acrylamide results in decreased expression of A1CF mRNA CTD PMID:30807115 A1cf Rat aflatoxin B1 affects expression ISO A1CF (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of A1CF protein CTD PMID:20106945 A1cf Rat aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of A1CF mRNA CTD PMID:33354967 A1cf Rat aflatoxin B1 decreases expression ISO A1CF (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of A1CF mRNA CTD PMID:27153756 A1cf Rat aflatoxin B1 multiple interactions EXP 6480464 [sulforaphane co-treated with Aflatoxin B1] affects the expression of A1CF mRNA CTD PMID:25450479 A1cf Rat arsenous acid multiple interactions ISO A1CF (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to A1CF protein] CTD PMID:26598702 A1cf Rat benzene increases expression EXP 6480464 Benzene results in increased expression of A1CF mRNA CTD PMID:15878777 A1cf Rat benzo[a]pyrene decreases methylation ISO A1CF (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of A1CF promoter CTD PMID:27901495 A1cf Rat benzo[a]pyrene decreases expression ISO A1CF (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of A1CF mRNA CTD PMID:32234424 A1cf Rat benzo[a]pyrene affects methylation ISO A1CF (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of A1CF 5' UTR CTD PMID:27901495 A1cf Rat bis(2-ethylhexyl) phthalate increases expression ISO A1cf (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of A1CF mRNA CTD PMID:34319233 A1cf Rat bis(2-ethylhexyl) phthalate multiple interactions ISO A1cf (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased methylation of and results in decreased expression of A1CF mRNA CTD PMID:34120004 A1cf Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of A1CF mRNA CTD PMID:25181051 A1cf Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of A1CF mRNA CTD PMID:32145629 A1cf Rat butanal increases expression ISO A1CF (Homo sapiens) 6480464 butyraldehyde results in increased expression of A1CF mRNA CTD PMID:26079696 A1cf Rat cadmium dichloride increases expression ISO A1cf (Mus musculus) 6480464 Cadmium Chloride results in increased expression of A1CF mRNA CTD PMID:24982889 A1cf Rat chlorpyrifos decreases expression ISO A1cf (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of A1CF mRNA CTD PMID:37019170 A1cf Rat cisplatin decreases expression ISO A1CF (Homo sapiens) 6480464 Cisplatin results in decreased expression of A1CF mRNA CTD PMID:27392435 A1cf Rat cisplatin multiple interactions ISO A1CF (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of A1CF mRNA CTD PMID:27392435 A1cf Rat copper(II) sulfate decreases expression ISO A1CF (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of A1CF mRNA CTD PMID:19549813 A1cf Rat cyclosporin A decreases expression ISO A1CF (Homo sapiens) 6480464 Cyclosporine results in decreased expression of A1CF mRNA CTD PMID:20106945 and PMID:25562108 A1cf Rat diarsenic trioxide multiple interactions ISO A1CF (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to A1CF protein] CTD PMID:26598702 A1cf Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of A1CF mRNA CTD PMID:29391264 A1cf Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of A1CF mRNA CTD PMID:18035473 A1cf Rat furan increases methylation EXP 6480464 furan results in increased methylation of A1CF gene CTD PMID:22079235 A1cf Rat GW 4064 increases expression ISO A1cf (Mus musculus) 6480464 GW 4064 results in increased expression of A1CF mRNA CTD PMID:26655953 A1cf Rat hydrogen peroxide affects expression ISO A1CF (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of ACF mRNA CTD PMID:20044591 A1cf Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of A1CF mRNA CTD PMID:24136188 A1cf Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of A1CF mRNA CTD PMID:33484710 A1cf Rat paracetamol decreases expression ISO A1CF (Homo sapiens) 6480464 Acetaminophen results in decreased expression of A1CF mRNA CTD PMID:29067470 A1cf Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of A1CF mRNA CTD PMID:28511854 A1cf Rat phenobarbital increases expression ISO A1cf (Mus musculus) 6480464 Phenobarbital results in increased expression of A1CF mRNA CTD PMID:19270015 A1cf Rat quercetin decreases expression ISO A1CF (Homo sapiens) 6480464 Quercetin results in decreased expression of A1CF mRNA CTD PMID:21632981 A1cf Rat silicon dioxide decreases expression ISO A1CF (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of A1CF mRNA CTD PMID:23806026 and PMID:25895662 A1cf Rat sodium arsenite decreases expression ISO A1CF (Homo sapiens) 6480464 sodium arsenite results in decreased expression of A1CF mRNA CTD PMID:29301061 A1cf Rat sodium arsenite increases expression ISO A1cf (Mus musculus) 6480464 sodium arsenite results in increased expression of A1CF mRNA CTD PMID:37682722 A1cf Rat sulforaphane multiple interactions EXP 6480464 [sulforaphane co-treated with Aflatoxin B1] affects the expression of A1CF mRNA CTD PMID:25450479 A1cf Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of A1CF mRNA] CTD PMID:31150632 A1cf Rat tetrachloromethane decreases expression ISO A1cf (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of A1CF mRNA CTD PMID:31919559 A1cf Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of A1CF mRNA CTD PMID:31150632 A1cf Rat tetraphene decreases expression ISO A1cf (Mus musculus) 6480464 benz(a)anthracene results in decreased expression of A1CF mRNA CTD PMID:26377693 A1cf Rat urethane decreases expression ISO A1CF (Homo sapiens) 6480464 Urethane results in decreased expression of A1CF mRNA CTD PMID:28818685 A1cf Rat valproic acid decreases methylation ISO A1CF (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of A1CF gene CTD PMID:29154799 A1cf Rat valproic acid affects expression ISO A1CF (Homo sapiens) 6480464 Valproic Acid affects the expression of A1CF mRNA CTD PMID:25979313 A1cf Rat valproic acid decreases expression ISO A1CF (Homo sapiens) 6480464 Valproic Acid results in decreased expression of A1CF mRNA CTD PMID:29154799
(+)-catechin (ISO) (+)-schisandrin B (EXP) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 7,9-dihydro-1H-purine-2,6,8(3H)-trione (ISO) acrylamide (EXP,ISO) aflatoxin B1 (EXP,ISO) arsenous acid (ISO) benzene (EXP) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) butanal (ISO) cadmium dichloride (ISO) chlorpyrifos (ISO) cisplatin (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) diarsenic trioxide (ISO) endosulfan (EXP) flavonoids (EXP) furan (EXP) GW 4064 (ISO) hydrogen peroxide (ISO) nefazodone (EXP) nitrofen (EXP) paracetamol (ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) quercetin (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sulforaphane (EXP) tetrachloromethane (EXP,ISO) tetraphene (ISO) urethane (ISO) valproic acid (ISO)
Biological Process
cytidine to uridine editing (IEA,IMP,ISO,TAS) embryo implantation (IEA,ISO) mRNA localization resulting in post-transcriptional regulation of gene expression (IEA,ISO) mRNA modification (IEA,ISO) mRNA processing (IEA) negative regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay (IEA,ISO) positive regulation of protein secretion (IMP) protein stabilization (IEA,ISO,ISS)
1.
Reduced expression and increased CpG dinucleotide methylation of the rat APOBEC-1 promoter in transgenic rabbits.
Apostel F, etal., Biochim Biophys Acta 2002 Sep 27;1577(3):384-94.
2.
A novel nuclear localization signal in the auxiliary domain of apobec-1 complementation factor regulates nucleocytoplasmic import and shuttling.
Blanc V, etal., J Biol Chem. 2003 Oct 17;278(42):41198-204. Epub 2003 Aug 1.
3.
[Effect of truncal vagotomy on the exocrine function of the pancreas in the dog]
Dabrowski Z, etal., Pol Tyg Lek 1978 Jul 10;33(28):1093-5.
4.
Effects of multiple genetic loci on the pathogenesis from serum urate to gout.
Dong Z, etal., Sci Rep. 2017 Mar 2;7:43614. doi: 10.1038/srep43614.
5.
Metabolic regulation of APOBEC-1 complementation factor trafficking in mouse models of obesity and its positive correlation with the expression of ApoB protein in hepatocytes.
Galloway CA, etal., Biochim Biophys Acta. 2010 Nov;1802(11):976-85. doi: 10.1016/j.bbadis.2010.06.003. Epub 2010 Jun 9.
6.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.
Metabolic regulation of apoB mRNA editing is associated with phosphorylation of APOBEC-1 complementation factor.
Lehmann DM, etal., Nucleic Acids Res. 2006 Jul 4;34(11):3299-308. Print 2006.
8.
Purification and molecular cloning of a novel essential component of the apolipoprotein B mRNA editing enzyme-complex.
Lellek H, etal., J Biol Chem. 2000 Jun 30;275(26):19848-56.
9.
Molecular cloning of apobec-1 complementation factor, a novel RNA-binding protein involved in the editing of apolipoprotein B mRNA.
Mehta A, etal., Mol Cell Biol. 2000 Mar;20(5):1846-54.
10.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.
In vitro deamination of cytosine to uracil in single-stranded DNA by apolipoprotein B editing complex catalytic subunit 1 (APOBEC1).
Petersen-Mahrt SK and Neuberger MS, J Biol Chem 2003 May 30;278(22):19583-6. Epub 2003 Apr 14.
12.
Interaction of the GCKR and A1CF loci with alcohol consumption to influence the risk of gout.
Rasheed H, etal., Arthritis Res Ther. 2017 Jul 5;19(1):161. doi: 10.1186/s13075-017-1369-y.
13.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
[Experience in the certification of veterinary specialists].
Romanenko AV, Veterinariia. 1978 Dec;(12):47-8.
16.
The editosome for cytidine to uridine mRNA editing has a native complexity of 27S: identification of intracellular domains containing active and inactive editing factors.
Sowden MP, etal., J Cell Sci 2002 Mar 1;115(Pt 5):1027-39.
A1cf Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 239,149,436 - 239,242,460 (+) NCBI GRCr8 mRatBN7.2 1 229,736,037 - 229,823,499 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 229,736,106 - 229,824,354 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 238,102,542 - 238,188,586 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 245,032,243 - 245,118,286 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 237,866,865 - 237,946,606 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 250,426,027 - 250,514,245 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 250,426,158 - 250,514,866 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 257,660,187 - 257,747,893 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 235,865,843 - 235,958,065 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 236,029,865 - 236,122,088 (+) NCBI Celera 1 226,856,680 - 226,943,695 (+) NCBI Celera Cytogenetic Map 1 q52 NCBI
A1CF Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 50,799,409 - 50,885,627 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 50,799,409 - 50,885,675 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 52,559,169 - 52,645,387 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 52,236,331 - 52,315,441 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 52,236,330 - 52,315,441 NCBI Celera 10 45,829,119 - 45,908,228 (-) NCBI Celera Cytogenetic Map 10 q11.23 NCBI HuRef 10 46,537,685 - 46,623,956 (-) NCBI HuRef CHM1_1 10 52,841,000 - 52,927,266 (-) NCBI CHM1_1 T2T-CHM13v2.0 10 51,648,044 - 51,734,261 (-) NCBI T2T-CHM13v2.0
A1cf Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 31,846,156 - 31,929,765 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 31,846,164 - 31,926,395 (+) Ensembl GRCm39 Ensembl GRCm38 19 31,868,756 - 31,952,365 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 31,868,764 - 31,948,995 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 31,943,251 - 32,023,896 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 31,934,758 - 32,015,403 (+) NCBI MGSCv36 mm8 Celera 19 32,656,858 - 32,737,433 (+) NCBI Celera Cytogenetic Map 19 C1 NCBI
A1cf Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955425 5,992,538 - 6,077,770 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955425 5,992,538 - 6,077,769 (-) NCBI ChiLan1.0 ChiLan1.0
A1CF Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 63,106,674 - 63,197,715 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 63,111,996 - 63,203,037 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 47,451,293 - 47,538,062 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 49,588,168 - 49,675,543 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 49,588,168 - 49,675,543 (-) Ensembl panpan1.1 panPan2
A1CF Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 26 37,027,165 - 37,109,842 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 26 37,027,275 - 37,102,888 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 26 36,912,827 - 36,995,367 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 26 38,560,154 - 38,642,825 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 26 38,560,187 - 38,636,835 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 26 36,461,590 - 36,550,642 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 26 36,048,241 - 36,131,022 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 26 37,288,420 - 37,371,161 (+) NCBI UU_Cfam_GSD_1.0
A1cf
A1CF Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 98,908,630 - 98,987,524 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 98,908,585 - 98,990,362 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 107,777,628 - 107,848,254 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
A1CF Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 80,286,872 - 80,367,587 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 80,314,081 - 80,370,348 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 40,941,786 - 41,019,626 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
A1cf
.
Predicted Target Of
Count of predictions: 87 Count of miRNA genes: 71 Interacting mature miRNAs: 76 Transcripts: ENSRNOT00000052256, ENSRNOT00000067643 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
8693637 Alc29 Alcohol consumption QTL 29 2.7 0.258 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 207987464 234238494 Rat 1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 61455 Niddm7 Non-insulin dependent diabetes mellitus QTL 7 5.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 214537555 238757011 Rat 61327 Eae7 Experimental allergic encephalomyelitis QTL 7 5.6 body mass (VT:0001259) change in body weight (CMO:0002045) 1 216255568 260522016 Rat 1600392 Bw123 Body weight QTL 123 0.001 body mass (VT:0001259) body weight (CMO:0000012) 1 223201027 260522016 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1600397 Edcs4 Endometrial carcinoma susceptibility QTL 4 2.2 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 1 206081677 251081677 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 1300108 Rf8 Renal function QTL 8 3.75 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 1 228581588 259647894 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 734767 Niddm57 Non-insulin dependent diabetes mellitus QTL 57 body mass (VT:0001259) body weight (CMO:0000012) 1 224054293 260122809 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631215 Stl8 Serum triglyceride level QTL 8 9.27 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 1 225126575 260522016 Rat 631843 Bw116 Body weight QTL 116 4.1 0.016 abdominal adipose amount (VT:1000220) abdominal fat pad weight (CMO:0000088) 1 224054293 260122809 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 731175 Uae20 Urinary albumin excretion QTL 20 3.5 0.0018 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 221264111 259647894 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 724538 Kidm1 Kidney mass QTL 1 3.2 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 213707201 252085212 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 734769 Niddm58 Non-insulin dependent diabetes mellitus QTL 58 body mass (VT:0001259) body weight (CMO:0000012) 1 224569538 260122809 Rat 734768 Niddm59 Non-insulin dependent diabetes mellitus QTL 59 body mass (VT:0001259) body weight (CMO:0000012) 1 213843987 258843987 Rat 1358890 Bp259 Blood pressure QTL 259 3.06 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 210702053 260522016 Rat 724533 Rf51 Renal function QTL 51 5.3 0.0002 kidney plasma flow trait (VT:0005524) renal plasma flow (CMO:0001914) 1 218753816 256448513 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 1549910 Bw54 Body weight QTL 54 0.05 body mass (VT:0001259) body weight (CMO:0000012) 1 214647894 259647894 Rat 70211 Niddm24 Non-insulin dependent diabetes mellitus QTL 24 3.79 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 214647894 259647894 Rat 1357399 Bw45 Body weight QTL 45 3.05 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 1 206329708 251329708 Rat 724552 Glom2 Glomerulus QTL 2 3.3 0.0001 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 1 222363780 260522016 Rat 2316896 Gluco57 Glucose level QTL 57 7.2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 228985440 245907899 Rat 1357404 Bw42 Body weight QTL 42 4.49 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 1 206329708 251329708 Rat 10053715 Scort24 Serum corticosterone level QTL 24 2.13 0.0088 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 221414816 260522016 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 1358916 Kidm22 Kidney mass QTL 22 3.32 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 210702053 240947965 Rat 2312564 Glom18 Glomerulus QTL 18 2.4 0.003 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 185356336 231689108 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 61400 Niddm1 Non-insulin dependent diabetes mellitus QTL 1 11 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 218753689 245907899 Rat 10059587 Bw173 Body weight QTL 173 3.23 0.025 body mass (VT:0001259) body weight (CMO:0000012) 1 202069611 247069611 Rat 2292216 Bw80 Body weight QTL 80 3.23 0.0019 body mass (VT:0001259) body weight (CMO:0000012) 1 213533809 243914901 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1641926 Teswt2 Testicular weight QTL 2 2.82 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 1 197697768 238755659 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 2293700 Bmd27 Bone mineral density QTL 27 6.6 0.0001 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 224054293 243747962 Rat 2293701 Bmd34 Bone mineral density QTL 34 8.3 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 1 224054293 243747962 Rat 7387289 Uae45 Urinary albumin excretion QTL 45 2.86 0.0021 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 223262787 260522016 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 1600363 Hc6 Hypercalciuria QTL 6 2.7 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 203995416 244113296 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 2302040 Pia35 Pristane induced arthritis QTL 35 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 216255568 260522016 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat 1598821 Rf55 Renal function QTL 55 6.3 renal blood flow trait (VT:2000006) ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239) 1 218748008 257976495 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
6
9
42
88
85
59
23
59
6
165
50
22
41
43
26
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000067643 ⟹ ENSRNOP00000062802
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 229,736,106 - 229,824,354 (+) Ensembl Rnor_6.0 Ensembl 1 250,426,158 - 250,514,866 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000106085 ⟹ ENSRNOP00000095037
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 229,736,106 - 229,806,404 (+) Ensembl
RefSeq Acc Id:
NM_133400 ⟹ NP_596891
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 239,149,493 - 239,235,442 (+) NCBI mRatBN7.2 1 229,736,106 - 229,822,097 (+) NCBI Rnor_6.0 1 250,426,192 - 250,512,413 (+) NCBI Rnor_5.0 1 257,660,187 - 257,747,893 (+) NCBI RGSC_v3.4 1 235,865,843 - 235,958,065 (+) RGD Celera 1 226,856,680 - 226,943,695 (+) RGD
Sequence:
GAATTCACCATAATCAAGAAACCTTTTCCGGGTGGGGGAACCTCAGAAATTACTCAGTGAGCAACCCTAATTAACCTGATTTTTTGCTGATAATCACTCTCAATGGAATCAAATCACAAATCCGGGGA
hide sequence
RefSeq Acc Id:
XM_006231272 ⟹ XP_006231334
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 239,149,436 - 239,242,460 (+) NCBI mRatBN7.2 1 229,736,115 - 229,823,499 (+) NCBI Rnor_6.0 1 250,426,027 - 250,514,245 (+) NCBI Rnor_5.0 1 257,660,187 - 257,747,893 (+) NCBI
Sequence:
GCTTCTGTTCAGGCCATAGTGACCCAATTACCTGGTCAAAGGGCTGAGTGAATGCAAGAGGAGGGTGAGTTAAAGTTTAACTCCCAGGAATTGTAAACCAAACCTACAGCCACTGAACCTTTGGAGTT
hide sequence
RefSeq Acc Id:
XM_039085015 ⟹ XP_038940943
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 239,149,436 - 239,242,460 (+) NCBI mRatBN7.2 1 229,736,037 - 229,823,499 (+) NCBI
RefSeq Acc Id:
NP_596891 ⟸ NM_133400
- UniProtKB:
Q924K3 (UniProtKB/Swiss-Prot), Q8CH58 (UniProtKB/Swiss-Prot), Q8CH57 (UniProtKB/Swiss-Prot), Q8CH56 (UniProtKB/Swiss-Prot), Q8CH55 (UniProtKB/Swiss-Prot), Q923K9 (UniProtKB/Swiss-Prot)
- Sequence:
MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDTTPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKQEAKNAIKQLNNYEIRNGRLLG
hide sequence
RefSeq Acc Id:
XP_006231334 ⟸ XM_006231272
- Peptide Label:
isoform X1
- UniProtKB:
Q924K3 (UniProtKB/Swiss-Prot), Q923K9 (UniProtKB/Swiss-Prot), Q8CH58 (UniProtKB/Swiss-Prot), Q8CH57 (UniProtKB/Swiss-Prot), Q8CH56 (UniProtKB/Swiss-Prot), Q8CH55 (UniProtKB/Swiss-Prot), F1LNL0 (UniProtKB/TrEMBL)
- Sequence:
MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDTTPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKQEAKNAIKQLNNYEIRNGRLLG
hide sequence
Ensembl Acc Id:
ENSRNOP00000062802 ⟸ ENSRNOT00000067643
RefSeq Acc Id:
XP_038940943 ⟸ XM_039085015
- Peptide Label:
isoform X2
- UniProtKB:
A6I0Z6 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000095037 ⟸ ENSRNOT00000106085
RGD ID: 13690855 Promoter ID: EPDNEW_R1380 Type: initiation region Name: A1cf_1 Description: APOBEC1 complementation factor SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 250,426,201 - 250,426,261 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-06-23
A1cfT
APOBEC1 complementation factorT
A1cf
APOBEC1 complementation factor
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-06-23
A1cf
APOBEC1 complementation factor
A1cfT
APOBEC1 complementation factorT
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-06-11
A1cft
APOBEC1 complementation factort
A1cf
APOBEC1 complementation factor
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-06-11
A1cf
APOBEC1 complementation factor
A1cft
APOBEC1 complementation factort
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-05-08
A1cf
APOBEC1 complementation factor
Acf
apobec-1 complementation factor
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Acf
apobec-1 complementation factor
Apobec-1 complementation factor, APOBEC-1 stimulating protein
Name updated
1299863 APPROVED
2002-08-07
Acf
Apobec-1 complementation factor, APOBEC-1 stimulating protein
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_protein
66 kDa protein
631910
